
Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29926 produits trouvés pour "Peptides"
H-ENATVAHL^VGALR-OH
Peptide H-ENATVAHL^VGALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GHFPLAER^-OH
Peptide H-GHFPLAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SIPQVSPVR^-OH
Peptide H-SIPQVSPVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MDILSYMR^-OH
Peptide H-MDILSYMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGAQATWTELPWPHEK^-OH
Peptide H-SGAQATWTELPWPHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YVYIAELLAHK^-OH
Peptide H-YVYIAELLAHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVAVYADQAK^-OH
Peptide H-AVAVYADQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVIDDAFAR^-OH
Peptide H-AVIDDAFAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NRPTSISWDGLDSGK^-OH
Peptide H-NRPTSISWDGLDSGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HIV-1 gag Protein p24 (65-73) (isolates MAL/U455)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C44H79N11O14S2Masse moléculaire :1,050.31 g/molH-VVV^GAVGVGK^-OH
Peptide H-VVV^GAVGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLATVYVDVLK^-OH
Peptide H-DLATVYVDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-IDMVD-OH
Peptide Ac-IDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEQY^NSTYR-OH
Peptide H-EEQY^NSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Azido-RKKRRQRRR-NH2
Peptide 5Azido-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
RK9, p17 Gag (20 - 28)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C45H86N18O10Masse moléculaire :1,039.3 g/mol5Fam-VIFDANAPVAVR-OH
Peptide 5Fam-VIFDANAPVAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-KNIVTPRTPPPSQGK-NH2
Peptide LCBiot-KNIVTPRTPPPSQGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ara h1 (555-577) peanut allergen
Ara h 1 is one of the major allergenic proteins from peanut (Arachis hypogaea) which contains approximately 13 potential allergenic proteins.Ara h 1 is a member of the 7/8 S globulin (vicilin) family of seed storage proteins belonging to the cupin superfamily and is the most abundant allergen present in the peanut kernel. Ara h 1 plays an important role in the allergy sensitising procedure and can be recognised by 90% of patients with a peanut allergy.This peptide represents a tryptic peptide of Ara h 1.Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,375.7 g/molH-FATVEVTDK^-OH
Peptide H-FATVEVTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RHSVV-NH2
Peptide H-RHSVV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GQAEVTQDPAPLLR^-OH
Peptide H-GQAEVTQDPAPLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TVQDALSSVQESDIAVVAR^-OH
Peptide H-TVQDALSSVQESDIAVVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALDFAVSEYNK^-OH
Peptide H-ALDFAVSEYNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLLQTLR^-OH
Peptide H-VLLQTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RHFWQQDEPPQSPWDR^-OH
Peptide H-RHFWQQDEPPQSPWDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ruth-SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP-NH2
Peptide Ruth-SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LIQGAPTIR^-OH
Peptide H-LIQGAPTIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTTLITNLSSVLK^-OH
Peptide H-GTTLITNLSSVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTYSTTVTGR^-OH
Peptide H-GTYSTTVTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-YPYDVPDYAC-OH
Peptide Ac-YPYDVPDYAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTTGADVR^-OH
Peptide H-LTTGADVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVVVGADGVGK^-OH
Peptide H-LVVVGADGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPLTATLSK^-OH
Peptide H-TPLTATLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NVALLALPR^-OH
Peptide H-NVALLALPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Wang Resin (200-400 mesh) 1% DVB
Wang Resin is a resin for peptide synthesis with a high loading capacity. Wang Resin is an unsubstituted polystyrene resin and has been used in peptide synthesis as a solid phase. It can be used as a building block to create other resins or as a solid phase support in peptide synthesis. Wang Resin is also used in the manufacture of pharmaceuticals, agrochemicals, and cosmetics.
Degré de pureté :Min. 95%H-GEEPLYWSFPAKKK-NH2
Peptide H-GEEPLYWSFPAKKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CEQKLISEEDL-NH2
Peptide Ac-CEQKLISEEDL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NEPEK^-OH
Peptide H-NEPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DRV^YIHPFH-OH
Peptide H-DRV^YIHPFH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-LAKAVDGYVKPQIKQ-NH2
Peptide LCBiot-LAKAVDGYVKPQIKQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NILTSNNIDVK^-OH
Peptide H-NILTSNNIDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ESQAYYDGR^-OH
Peptide H-ESQAYYDGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DNEAYEMPSEEGYQD-NH2
Peptide H-DNEAYEMPSEEGYQD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSEDPNEDIVER^-OH
Peptide H-SSEDPNEDIVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CAQK^-NH2
Peptide Ac-CAQK^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GPTHLFQPSLVLDMAKVLD-NH2
Peptide Ac-GPTHLFQPSLVLDMAKVLD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGGDLGTYVINK^-OH
Peptide H-LGGDLGTYVINK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CTQRGNVAKTSRNAPEEK-NH2
Peptide Ac-CTQRGNVAKTSRNAPEEK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GNFHAVYR^-OH
Peptide H-GNFHAVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGRGKGGKGLGKGGAKRHRKVL-NH2
Peptide H-SGRGKGGKGLGKGGAKRHRKVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Myr-SIYRRGARRWRKLYRAN-OH
Peptide Myr-SIYRRGARRWRKLYRAN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 116 (TVAPEEDTDEDSDNE)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,665.6 g/molH-LLVEELPLR^-OH
Peptide H-LLVEELPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALVILAK^-OH
Peptide H-ALVILAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVDGYVKPQIK^-OH
Peptide H-AVDGYVKPQIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DITP^TLTLYVGK^-OH
Peptide H-DITP^TLTLYVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
BD-2, recombinant Human
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C188H305N55O50S6Masse moléculaire :4,328.23 g/molH-NGLHLPSYSPYPR^-OH
Peptide H-NGLHLPSYSPYPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RSGPPGL^QGRL^QRL^L^QASGNHAAGIL^TM-NH2
Peptide H-RSGPPGL^QGRL^QRL^L^QASGNHAAGIL^TM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLVVHEK^-OH
Peptide H-TLVVHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVFDDTYDR^-OH
Peptide H-VVFDDTYDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-MTATHAVDEAVS-NH2
Peptide Ac-MTATHAVDEAVS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FMOC-PQP-OH
Peptide FMOC-PQP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
S-Trityl-ß-Mercaptopropionyl-p-Methyl-Benzhydrylamine Resin
S-Trityl-ß-Mercaptopropionyl-p-Methyl-Benzhydrylamine Resin is a resin that is used in the synthesis of peptides. It has a high efficiency and can be used in protein ligation and other peptide syntheses. This resin is available in both small molecule and large molecule formats, with modifications for specific purposes such as building blocks for protein synthesis or ligation.Degré de pureté :Min. 95%CMVpp65 - 13 (RVSQPSLILVSQYTP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,688 g/molH-AAIQAL^R-OH
Peptide H-AAIQAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-LLGIWGC-NH2
Peptide LCBiot-LLGIWGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Arg(Pbf)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Arg(Pbf)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin used in the synthesis of peptides. This resin contains two amino acid residues that are used to form peptide bonds. These residues can be either H-Arg or H-Lys, but not both. The resin also contains a reagent called 2,4,6-trichlorophenoxyacetic acid (Troc), which reacts with the NH groups on the amino acids to form an ester linkage. The resin is typically used for building blocks and as an intermediate for synthesizing more complex molecules such as peptides and proteins.
Degré de pureté :Min. 95%LCBiot-AESPKKP-OH
Peptide LCBiot-AESPKKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PYA-WND-methylamide
Peptide PYA-WND-methylamide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 85 (VELRQYDPVAALFFF)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,815.1 g/molCyclin-A1 (385-395)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-RRPHFP^QFSYSASGTA-OH
Peptide H-RRPHFP^QFSYSASGTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPETLCGAELVDALQFVCGDR^-OH
Peptide H-GPETLCGAELVDALQFVCGDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 122 (PPWQAGILARNLVPM)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,663 g/molBivalirudin (3-20)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Ac-KKARFSRFAGSSPSQSSMVAR-NH2
Peptide Ac-KKARFSRFAGSSPSQSSMVAR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CMSGTGIRSVTGTPY-NH2
Peptide Ac-CMSGTGIRSVTGTPY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 22 (SEVENVSVNVHNPTG)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,581.7 g/molAc-CTPYDINQM-NH2
Peptide Ac-CTPYDINQM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEAPSLRPAPPPISGGGYR^-OH
Peptide H-EEAPSLRPAPPPISGGGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
AYPGKF-NH2
CAS :Peptide AYPGKF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formule :C34H48N8O7Masse moléculaire :680.79 g/molLeu-Thr-Ile-Ile-Pro-Gln-Asp-Pro-Ile-Leu-Phe-Ser-Gl
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C82H136N20O23Masse moléculaire :1,770.08 g/molH-DSSEEK^-OH
Peptide H-DSSEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GGGGGC-NH2
Peptide H-GGGGGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CTSSLANQPRLEDFLK-OH
Peptide Ac-CTSSLANQPRLEDFLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLLASPR^-OH
Peptide H-LLLASPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.WT1 126-134 mutant (HLA-A*02:01) 126Y
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C55H74N10O13SMasse moléculaire :1,115.3 g/molH-IL^GG-NH2
Peptide H-IL^GG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HIV - 1 MN ENV - 176
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,658.9 g/molH-QDGNEEMGGITQTPY-NTPEGBiot
Peptide H-QDGNEEMGGITQTPY-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
IL 1 beta Human
IL-1 beta is a cytokine that plays an important role in the inflammatory response. IL-1 beta is produced by macrophages, monocytes, and fibroblasts in response to stimuli such as lipopolysaccharide (LPS), bacterial endotoxin, and other cytokines. It is also produced by keratinocytes and dendritic cells in response to bacterial products. IL-1 beta binds to the IL-1 receptor on the cell surface membrane, triggering a cascade of reactions inside the cell that lead to changes in gene expression and protein production. IL-1 beta can be used as an indicator of inflammation due to its release by activated lymphocytes, natural killer cells, and neutrophils during acute infections. The presence of this substance indicates that there has been tissue damage or some other form of cell injury.
Degré de pureté :>98% By Sds-Page And Rp-Hplc.H-ELYETASELPR^-OH
Peptide H-ELYETASELPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TGDIVEFVCK^-OH
Peptide H-TGDIVEFVCK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPLTTPVGGGIR^-OH
Peptide H-GPLTTPVGGGIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PVDEALR^-OH
Peptide H-PVDEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
