
Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29890 produits trouvés pour "Peptides"
Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2
CAS :Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2 is an enzyme substrate that acts as a competitive inhibitor of the hepatitis C protease. It has been shown to inhibit the activity of the hepatitis C protease in cell culture, and can be used to identify other inhibitors of this protease. Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2 is a peptide with an amino acid sequence that is not found in any known proteins.
Formule :C68H89N15O25SDegré de pureté :Min. 95%Masse moléculaire :1,548.62 g/molH-VISPSEDR^-OH
Peptide H-VISPSEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVGAVGVGK^-OH
Peptide H-VVGAVGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Diprotin A
CAS :Diprotin A is a peptide that is involved in cell signaling and has been shown to interact with ion channels and receptors. It is an activator of the Fc receptor, which is responsible for the activation of immune cells. This peptide can also be used as a research tool to study protein interactions or as an antibody to study ligands or receptors. Diprotin A can be used in the pharmacological treatment of diseases such as cancer, inflammation, and pain.
Formule :C17H31N3O4Degré de pureté :Min. 95%Masse moléculaire :341.45 g/molLCBiot-LPETGG-OH
Peptide LCBiot-LPETGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VAPEEHPVLLTEAPLNPK^-OH
Peptide H-VAPEEHPVLLTEAPLNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CNP-22 (Human, Porcine, Rat)
CAS :CNP-22 is a peptide that has been shown to activate ion channels, inhibit protein interactions, and bind to receptors. It has been used in research as an antibody activator, ligand inhibitor, and receptor antagonist. CNP-22 is a non-protein with a molecular weight of 714.Formule :C93H157N27O28S3Degré de pureté :Min. 95%Masse moléculaire :2,197.6 g/molAoa-KSKTKC-OH
Peptide Aoa-KSKTKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Influenza B labeled 5-peptide mixture
Influenza B labelled 5-peptide mixture of: H-SHFANLK^-OHH-SYFANLK^-OHH-GVLLPQK^-OHH-NLNSLSELEVK^-OHH-GILLPQK^-OH K^ = Lysine (U-13C6,15N2) 100 aliquots/pack total to equal 1nmol/peptide/vial dry aliquotsAc-VGVAPG-NH2
Ac-VGVAPG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-VL^AVTDSPAR-OH
Peptide H-VL^AVTDSPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-PFAV
Peptide Fmoc-PFAV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-HWRGWVC-OH
Peptide Ac-HWRGWVC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-95/aa377 - 391
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,906.3 g/molH-IVGGWECEK^-OH
Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Asp-Glu-Val-Asp-pNA
CAS :Ac-Asp-Glu-Val-Asp-pNA is a peptide that is derived from the human tumor necrosis factor (TNF) precursor protein. It has been shown to inhibit the growth of tumor cells in vitro by inducing apoptosis. Ac-Asp-Glu-Val-Asp-pNA binds to and activates caspase 3, which leads to cleavage of the proapoptotic protein Bid into Bax and Bak, leading to mitochondrial membrane potential collapse and cell death. The peptide also inhibits DNA synthesis in HL60 cells and hemocytes. Ac-Asp-Glu-Val-Asp-pNA also inhibits proliferation of K562 cells through proteolytic degradation of the antiapoptotic protein Bcl2L11.Formule :C26H34N6O13Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :638.58 g/molADSA-CFTR
Peptide ADSA-CFTR is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-NH2
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormule :C190H288N54O57Masse moléculaire :4,240.7 g/molH-HSQGTFTSDYSK^YLDSRRAQDFVQWLMNTKR^NRNNIA-OH
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormule :C192H295N61O60SMasse moléculaire :4,449.9 g/molH-IVKWDRDM^-OH
Peptide H-IVKWDRDM^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NAVEVLKR^-OH
Peptide H-NAVEVLKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.gp100 (86-95)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H3 native 6-peptide mixture
H-STQAAIDQINGK-OHH-STQAAIDQISGK-OHH-SDAPIGK-OHH-DEALNNR-OHH-EFSEVEGR-OHH-TITNDR-OHPeptide purity: >98%AAA: Concentration - Duplicate100 aliquots/pack total to equal 1nmol/peptide/vial dry aliquotsZ-His-Glu-Lys-AMC
CAS :Z-His-Glu-Lys-AMC is an activator of ion channels. It is a ligand that binds to the receptor and stimulates the opening of ion channels in cells. Z-His-Glu-Lys-AMC has been used as a research tool to study protein interactions, pharmacology, and cell biology. It has also been used to study ion channel function and its role in diseases such as epilepsy or schizophrenia.
Formule :C35H41N7O9Degré de pureté :Min. 95%Masse moléculaire :703.74 g/molPLP (139-151)
CAS :PLP (139-151) is derived from Proteolipid Protein (PLP), an epitope of immunodominant encephalitogenic PLP and is involved in promoting encephalomyelitis.Formule :C72H104N20O17Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,520.8 g/molRetatrutide
CAS :GLP-1, GIP, and GCGR2 mimic; Obesity research
Formule :C221H342N46O68Degré de pureté :Min. 99 Area-%Masse moléculaire :4,731.33 g/molH-IGGHGAEYGAEALER^-OH
Peptide H-IGGHGAEYGAEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LHGGSPWPPCQYR^-OH
Peptide H-LHGGSPWPPCQYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myelin PLP (139-151)
CAS :Myelin PLP (139-151) is a basic protein that belongs to the family of oligodendrocyte-myelin glycoproteins. It has been shown to activate toll-like receptor, which is a pattern recognition receptor that recognizes invading pathogens and triggers an immune response. Myelin PLP (139-151) may play a role in the development of autoimmune diseases, as it has been found to be a target for autoantibodies. It has also been shown to have antioxidative properties, which may help prevent free radical damage in the brain and other tissues. The monoclonal antibody against this protein can be used for immunohistological analysis.Formule :C72H104N20O17Degré de pureté :Min. 95%Masse moléculaire :1,521.72 g/molH-DAAQK^TDTSHHDQDHPTF-OH
Peptide H-DAAQK^TDTSHHDQDHPTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CQLINTNGSWHINCK-NH2
Peptide Ac-CQLINTNGSWHINCK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPAMVVDR^-OH
Peptide H-IPAMVVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-NIQLINTNGSWHINST-NH2
Peptide Ac-NIQLINTNGSWHINST-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGNGVWIGR^-OH
Peptide H-YGNGVWIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQDGDLTLYQSNTILR^-OH
Peptide H-FQDGDLTLYQSNTILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
pE-LYENKPRRP^YIL^
pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormule :C73H116N20O18Masse moléculaire :1,561.84 g/molH-LNNISIIGPLDMK^-OH
Peptide H-LNNISIIGPLDMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.α-CGRP (mouse, rat)
CAS :Endogenous calcitonin gene-related peptide receptor (CGRP) agonist which is secreted in both peripheral and central neurons. It is a potent vasodilator and can function in the transmission of nociception as well as acting as an appetite suppressant and contributing to gastric acid secretion. It also has a function in temperature homeostasis, increases heart rate, and can play a role in the release of the pituitary hormone.Formule :C162H262N50O52S2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :3,806.25 g/molEpitope2-S133-A145-A
Research peptide matching Epitope2-S133-A145-AFormule :C76H114N20O23SCouleur et forme :PowderMasse moléculaire :1,725.92 g/molH-Thr-Phe-Leu-Leu-Arg-NH2
CAS :The endothelium is a layer of cells that lines the inner surface of blood vessels and lymphatic vessels, forming a barrier between circulating blood or lymph and the rest of the body. It is involved in maintaining vascular homeostasis as well as in inflammation. The endothelium regulates vascular tone and blood pressure through release of nitric oxide (NO) and other substances, such as prostacyclin, vasoactive peptides, endothelin-1, tumor necrosis factor-α, interleukin-1β, and thromboxane A2. Endothelial cells are activated by various means such as increased intracellular Ca2+ concentration or basic fibroblast growth factor (bFGF). This activation can be inhibited by receptor antagonists such as neurokinin-1 receptor antagonists.
Formule :C31H53N9O6Degré de pureté :Min. 95%Masse moléculaire :647.81 g/molH-QLSESQVK^-OH
Peptide H-QLSESQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-D-Thr(Bzl)-OH
CAS :Boc-D-Thr(Bzl)-OH is a peptide that is used as an activator or inhibitor of ion channels. It has been shown to inhibit the activity of L-type voltage dependent calcium channels and N-type voltage dependent sodium channels, as well as potassium channels. This peptide binds to the receptor site on the channel and blocks ion transport through the channel. Boc-D-Thr(Bzl)-OH can also be used to study protein interactions with receptors and ligands, as well as pharmacology.
Formule :C16H23NO5Degré de pureté :Min. 95%Masse moléculaire :309.36 g/molH-CSCSSLMDKECVY^FCHLDIIW^VNTPEHVVPYGL^GSPRS-OH
H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Z-Leu-Leu-Leu-H (aldehyde)
CAS :Z-Leu-Leu-Leu-H (aldehyde) is an inhibitor that binds to a receptor and prevents the binding of a ligand. This competitive inhibition is reversible and can be used as a research tool to study protein interactions. The high purity of this product makes it ideal for use in pharmacology, cell biology, and life science research.Formule :C26H41N3O5Degré de pureté :Min. 95%Masse moléculaire :475.62 g/molAc-DESDFGPLVGADS-NH2
Peptide Ac-DESDFGPLVGADS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-A^Q-OH
Peptide H-A^Q-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYLPAVDEK^-OH
Peptide H-TYLPAVDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GNDISSGTVLSDYVGSGPPK^-OH
Peptide H-GNDISSGTVLSDYVGSGPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLQTSQDAR^-OH
Peptide H-GLQTSQDAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTIAALLSPYSYSTTAVVTNPK^E-OH
Peptide H-YTIAALLSPYSYSTTAVVTNPK^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FASFIER^-OH
Peptide H-FASFIER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSITIRPR^-OH
Peptide H-LSITIRPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-IEGR-OH
Peptide Ac-IEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-Lys(Cl-Z)-OH
CAS :Boc-Lys(Cl-Z)-OH is a research tool that belongs to the group of peptides. It is an inhibitor of ion channels and can be used as a pharmacological agent. Boc-Lys(Cl-Z)-OH is an agonist of G protein coupled receptors, which are found on cell membranes. It may also be used to activate receptor tyrosine kinases. Boc-Lys(Cl-Z)-OH is a high purity product with > 99% purity.
Formule :C19H27N2O6ClDegré de pureté :Min. 95%Masse moléculaire :414.88 g/molBiotin-β Amyloid (1-42) Human
Amyloid β-protein (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.This peptide contains a covalently attached N-Terminal biotin tag for convenient detection and purification.Degré de pureté :Min. 95%Couleur et forme :PowderLCBiot-RAHEEIYHFFFAKKK-OH
Peptide LCBiot-RAHEEIYHFFFAKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-FAVP
Peptide Fmoc-FAVP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biotin-Kemptide
Catalogue peptide; min. 95% purity
Formule :C42H75N15O11SMasse moléculaire :998.22 g/molH-WYQSIR^-OH
Peptide H-WYQSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyclo(Arg-Gly-Asp-D-Phe-Cys)
CAS :Cyclo(Arg-Gly-Asp-D-Phe-Cys) is a cyclic peptide that can form stable complexes with platinum. It has been shown to have anticancer activity against cervical cancer cells in tissue culture. Cyclo(Arg-Gly-Asp-D-Phe-Cys) binds to the integrin receptor on the surface of cancer cells, which leads to changes in redox potential, leading to cell death by apoptosis or necrosis. Cyclo(Arg-Gly-Asp-D-Phe-Cys) also has pharmacological properties that make it a good candidate for treatment of cancer.
Formule :C24H34N8O7SDegré de pureté :Min. 95%Masse moléculaire :578.65 g/molH-DMQLGR^-OH
Peptide H-DMQLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLFIIDGK^-OH
Peptide H-GLFIIDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Leu-Pro-Phe-Phe-Asp-NH2
CAS :Ac-Leu-Pro-Phe-Phe-Asp-NH2 is a potential therapeutic for Alzheimer's disease. It has been shown to reduce the production of reactive oxygen species and inhibit the formation of amyloid beta oligomers. Ac-Leu-Pro-Phe-Phe-Asp-NH2 also reduces the frequency of protofibrils, which are aggregates that may play a role in Alzheimer's disease pathology. This peptide has been shown to have a protective effect on cell populations, which may lead to therapeutics that can delay or prevent Alzheimer's disease. Ac-Leu-Pro-Phe-Phe-Asp NH2 is an inhibitor of amyloid beta peptides and modulates their aggregation into protofibrils.
Formule :C35H46N6O8Degré de pureté :Min. 95%Masse moléculaire :678.89 g/molBoc-Cys(4-CH3Bzl)-OH
CAS :Boc-Cys(4-CH3Bzl)-OH is a building block for the synthesis of peptides and other biologically active molecules. It is a protected amino acid that can be used in peptide synthesis, and it is commonly used as a building block for the synthesis of Boc-protected L-amino acids.
Formule :C16H23NO4SDegré de pureté :Min. 95%Masse moléculaire :325.42 g/molCyc-Biot-CGKGRGLC-NH2
Peptide Cyc-Biot-CGKGRGLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-L^^GTL^^DNPSSL^^DETAYER-OH
Peptide H-L^^GTL^^DNPSSL^^DETAYER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Galacto-RGD2
When 99mTc-labeled, this cyclic RGD dimer is a useful tool for tumor imaging. This novel galacto RGD dimer has enhanced hydrophilic properties that improve biodistribution and tumor-imaging in comparison to 3P-RGD2 tracer. This product is available as a trifluoroacetate salt.
Formule :C91H137N29O32Degré de pureté :Min. 95%Masse moléculaire :2,149.24 g/molH-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH
H-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormule :C275H477N125O51Masse moléculaire :6,350.54 g/molBiotinyl-Gly-Gly-OH
CAS :Please enquire for more information about Biotinyl-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C14H22N4O5SDegré de pureté :Min. 95%Masse moléculaire :358.41 g/molH-LDSIICVK^-OH
Peptide H-LDSIICVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 109 (AGRKRKSASSATACT)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,494.7 g/molH-VYIHP^F-OH
Peptide H-VYIHP^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSFEDSVISLSGDHSIIGR^-OH
Peptide H-VSFEDSVISLSGDHSIIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Chemotactic Peptide
CAS :As a chemotactic peptide, For-Met-Leu-Phe (FMLP) has chemotactic properties, which means it can attract cells. For example it is a chemoattractant for phagocytic leukocytes and neutrophils. Neutrophils which have seven transmembrane G-protein coupled receptors are activated during the acute inflammatory response by FMLP and other chemotactic factors which bind to its surface receptors. This results in the activate of NF- κB, MAPK and PI3K pathways. In particular FMLP is known to induce Interleukin-8 (IL-8) which is responsible for both tissue damage and the pathogenesis of inflammatory processes resulting from neutrophils. Chemotactic peptide have been used to study the function of polymorphonuclear leukocytes and other white blood cells in inflammation. Chemotactic peptides are often used as fluorescent probes to measure intracellular metabolic responses to chemoattractant stimulation. This product is available as a 0.5mg vial.Formule :C21H31N3O5SDegré de pureté :Min. 95%Masse moléculaire :437.55 g/molH-R^MFPNAPYL-OH
Peptide H-R^MFPNAPYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPSVFPLAPSSR^-OH
Peptide H-GPSVFPLAPSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SNLELLR^-OH
Peptide H-SNLELLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVTVDTTLAGYHLPK^-OH
Peptide H-EVTVDTTLAGYHLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ala-Ala-Ala-pNA • HCl
CAS :H-Ala-Ala-Ala-pNA • HCl is a porcine pancreatic elastase inhibitor. It is a chromogenic substrate that inhibits the proteolytic activity of elastase by binding to the active site and blocking its access to the peptide bond. H-Ala-Ala-Ala-pNA • HCl is used as an enzyme inhibitor in biochemistry and molecular biology research, and has been shown to inhibit enzymatic activity of human leukocyte elastase. The peptide is also a substrate for astacin, which cleaves it at the Cys residue.Formule :C15H21N5O5•HClDegré de pureté :Min. 95%Masse moléculaire :387.83 g/molH-NSPGLLVSPGNLNK^-OH
Peptide H-NSPGLLVSPGNLNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biotin-Substance P
Substance P (SP) is a peptide that is highly conserved across the animal kingdom and is involved in a number of inflammatory and growth promoting processes. SP has a net positive charge at physiological pH, it is an amphiphilic peptide with positively charged residues at the N-terminus and hydrophobic residues at the C-terminus, this controls how it interacts with cell membranes. SP is stable in plasma (several hours) but has a short half-life in tissues (seconds/minutes).SP is encoded by the TAC1 gene and is a member of the tachykinin peptide hormone family. SP is expressed by many cell types including: neurons, astrocytes, microglia, epithelial cells, endothelial cells, immune cells such as T cells and macrophages- dendritic cells and eosinophils and some stem cells and progenitor cells. The huge variety of cell types expressing SP suggest it is involved in a wide variety of physiological and pathophysiological functions.SP mediates its functions by interacting with members of the neurokinin (NK) family of G protein-coupled receptors with high selectivity. Among these, SP binds to NK1R with the highest affinity, this receptor is expressed in a wide range of tissue types.Biotin (B7) has been added to the N-terminus.Formule :C73H112N20O15S2Masse moléculaire :1,573.96 g/molHBV core14, (HBA31)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C53H95N17O18Masse moléculaire :1,258.45 g/molH-Cit-AMC·HBr
CAS :Please enquire for more information about H-Cit-AMC·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C16H20N4O4·HBrDegré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :413.27 g/molH-TENNDHINLK^-OH
Peptide H-TENNDHINLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Neuromedin S (Human)
Neuromedin S (Human) is a peptide that belongs to the class of ligands. It is an activator of G-protein coupled receptors, ion channels and other membrane proteins. Neuromedin S (Human) has been shown to inhibit the binding of serotonin to its receptor, which may be due to its ability to compete with serotonin for binding sites. Neuromedin S (Human) has also been shown to activate potassium channels on the cell membrane.
Formule :C173H265N53O44Degré de pureté :Min. 95%Masse moléculaire :3,791.3 g/molH-GPEQTQGNFGDQELIR^-OH
Peptide H-GPEQTQGNFGDQELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYFPHFDVSHGSAQVK^-OH
Peptide H-TYFPHFDVSHGSAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTPVGR^-OH
Peptide H-YTPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHLTPE^EKS-OH
Peptide H-VHLTPE^EKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QQTVGGVNYFFDVEVGR^-OH
Peptide H-QQTVGGVNYFFDVEVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Nesfatin-1 (Rat)
Nesfatin-1 is a peptide hormone that is encoded by the NPY gene. It is found in the hypothalamus and pancreas, where it regulates appetite. Nesfatin-1 has been shown to reduce food intake in rats by activating the hypothalamic feeding center and suppressing the appetite center. It also stimulates glucose production in pancreatic beta cells and increases insulin release from pancreatic alpha cells. Nesfatin-1 (Rat) is a peptide hormone that is encoded by the NPY gene. It is found in the hypothalamus and pancreas, where it regulates appetite. Nesfatin-1 has been shown to reduce food intake in rats by activating the hypothalamic feeding center and suppressing the appetite center. It also stimulates glucose production in pancreatic beta cells and increases insulin release from pancreatic alpha cells.Formule :C424H684N116O136Degré de pureté :Min. 95%Masse moléculaire :9,582.88 g/molChymostatin
CAS :Chymostatin is a protein that inhibits the polymerase chain reaction (PCR) by binding to the DNA polymerase. It has been shown to have a hypoglycemic effect in mice with myocardial infarcts and can also induce apoptosis in inflammatory lesions. Chymostatin binds to intracellular targets, such as cell factor and pro-apoptotic protein, which are involved in energy metabolism and inflammatory lesion. The inhibition of these targets may be due to its chemical biology properties, which include the formation of disulfide bonds and basic proteins. Chymostatin is not active against bacterial cells but can inhibit enzyme activities in mammalian cells.
Formule :C31H42N6O7Degré de pureté :Min. 95%Masse moléculaire :610.71 g/molAc-QEAFSHIRIPLPH-OH
Peptide Ac-QEAFSHIRIPLPH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RERQR-OH
Peptide Ac-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-AACK-OH
Peptide Fmoc-AACK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSAQQVQGVHAR^-OH
Peptide H-VSAQQVQGVHAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AALEDTLAETEAR^-OH
Peptide H-AALEDTLAETEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.β-Neo-Endorphin
Peptide β-Neo-Endorphin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C54H77N13O12Masse moléculaire :1,100.3 g/molMethyltetrazine-AGYLLGKINLKALAALAKKIL-NH2
Peptide Methyltetrazine-AGYLLGKINLKALAALAKKIL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Pra-OH
CAS :Fmoc-Pra-OH is a bioconjugate used in Click Chemistry. Click Chemistry is a chemical reaction that joins two components together by forming an amide bond between the carboxyl group of one component and the amino group on the other component. Fmoc-Pra-OH was synthesized by reacting the epidermal growth factor (EGF) with a cyclic peptide containing an acid moiety, which was conjugated to the azide group of an azidopropargyl linker. This bioconjugate has been shown to have proliferative activity in vitro and structural studies have been performed to understand its reactivity.
Formule :C20H17NO4Degré de pureté :Min. 98.0 Area-%Masse moléculaire :335.36 g/mol
