Peptides

Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2 is an enzyme substrate that acts as a competitive inhibitor of the hepatitis C protease. It has been shown to inhibit the activity of the hepatitis C protease in cell culture, and can be used to identify other inhibitors of this protease. Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2 is a peptide with an amino acid sequence that is not found in any known proteins.

Peptide H-VVGAVGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Diprotin A is a peptide that is involved in cell signaling and has been shown to interact with ion channels and receptors. It is an activator of the Fc receptor, which is responsible for the activation of immune cells. This peptide can also be used as a research tool to study protein interactions or as an antibody to study ligands or receptors. Diprotin A can be used in the pharmacological treatment of diseases such as cancer, inflammation, and pain.

Peptide LCBiot-LPETGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VL^AVTDSPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-HWRGWVC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide ADSA-CFTR is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Z-His-Glu-Lys-AMC is an activator of ion channels. It is a ligand that binds to the receptor and stimulates the opening of ion channels in cells. Z-His-Glu-Lys-AMC has been used as a research tool to study protein interactions, pharmacology, and cell biology. It has also been used to study ion channel function and its role in diseases such as epilepsy or schizophrenia.

GLP-1, GIP, and GCGR2 mimic; Obesity research

Peptide H-DAAQK^TDTSHHDQDHPTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IPAMVVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FQDGDLTLYQSNTILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

The endothelium is a layer of cells that lines the inner surface of blood vessels and lymphatic vessels, forming a barrier between circulating blood or lymph and the rest of the body. It is involved in maintaining vascular homeostasis as well as in inflammation. The endothelium regulates vascular tone and blood pressure through release of nitric oxide (NO) and other substances, such as prostacyclin, vasoactive peptides, endothelin-1, tumor necrosis factor-α, interleukin-1β, and thromboxane A2. Endothelial cells are activated by various means such as increased intracellular Ca2+ concentration or basic fibroblast growth factor (bFGF). This activation can be inhibited by receptor antagonists such as neurokinin-1 receptor antagonists.

Boc-D-Thr(Bzl)-OH is a peptide that is used as an activator or inhibitor of ion channels. It has been shown to inhibit the activity of L-type voltage dependent calcium channels and N-type voltage dependent sodium channels, as well as potassium channels. This peptide binds to the receptor site on the channel and blocks ion transport through the channel. Boc-D-Thr(Bzl)-OH can also be used to study protein interactions with receptors and ligands, as well as pharmacology.

H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide H-TYLPAVDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GNDISSGTVLSDYVGSGPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Boc-Lys(Cl-Z)-OH is a research tool that belongs to the group of peptides. It is an inhibitor of ion channels and can be used as a pharmacological agent. Boc-Lys(Cl-Z)-OH is an agonist of G protein coupled receptors, which are found on cell membranes. It may also be used to activate receptor tyrosine kinases. Boc-Lys(Cl-Z)-OH is a high purity product with > 99% purity.

Catalogue peptide; min. 95% purity

Cyclo(Arg-Gly-Asp-D-Phe-Cys) is a cyclic peptide that can form stable complexes with platinum. It has been shown to have anticancer activity against cervical cancer cells in tissue culture. Cyclo(Arg-Gly-Asp-D-Phe-Cys) binds to the integrin receptor on the surface of cancer cells, which leads to changes in redox potential, leading to cell death by apoptosis or necrosis. Cyclo(Arg-Gly-Asp-D-Phe-Cys) also has pharmacological properties that make it a good candidate for treatment of cancer.

Peptide H-GLFIIDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Ac-Leu-Pro-Phe-Phe-Asp-NH2 is a potential therapeutic for Alzheimer's disease. It has been shown to reduce the production of reactive oxygen species and inhibit the formation of amyloid beta oligomers. Ac-Leu-Pro-Phe-Phe-Asp-NH2 also reduces the frequency of protofibrils, which are aggregates that may play a role in Alzheimer's disease pathology. This peptide has been shown to have a protective effect on cell populations, which may lead to therapeutics that can delay or prevent Alzheimer's disease. Ac-Leu-Pro-Phe-Phe-Asp NH2 is an inhibitor of amyloid beta peptides and modulates their aggregation into protofibrils.

Boc-Cys(4-CH3Bzl)-OH is a building block for the synthesis of peptides and other biologically active molecules. It is a protected amino acid that can be used in peptide synthesis, and it is commonly used as a building block for the synthesis of Boc-protected L-amino acids.

Peptide Cyc-Biot-CGKGRGLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-L^^GTL^^DNPSSL^^DETAYER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

When 99mTc-labeled, this cyclic RGD dimer is a useful tool for tumor imaging. This novel galacto RGD dimer has enhanced hydrophilic properties that improve biodistribution and tumor-imaging in comparison to 3P-RGD2 tracer. This product is available as a trifluoroacetate salt.

Please enquire for more information about Biotinyl-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-VSFEDSVISLSGDHSIIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-R^MFPNAPYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GPSVFPLAPSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TENNDHINLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Neuromedin S (Human) is a peptide that belongs to the class of ligands. It is an activator of G-protein coupled receptors, ion channels and other membrane proteins. Neuromedin S (Human) has been shown to inhibit the binding of serotonin to its receptor, which may be due to its ability to compete with serotonin for binding sites. Neuromedin S (Human) has also been shown to activate potassium channels on the cell membrane.

Peptide H-QQTVGGVNYFFDVEVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Chymostatin is a protein that inhibits the polymerase chain reaction (PCR) by binding to the DNA polymerase. It has been shown to have a hypoglycemic effect in mice with myocardial infarcts and can also induce apoptosis in inflammatory lesions. Chymostatin binds to intracellular targets, such as cell factor and pro-apoptotic protein, which are involved in energy metabolism and inflammatory lesion. The inhibition of these targets may be due to its chemical biology properties, which include the formation of disulfide bonds and basic proteins. Chymostatin is not active against bacterial cells but can inhibit enzyme activities in mammalian cells.

Peptide Ac-QEAFSHIRIPLPH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide β-Neo-Endorphin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Fmoc-Pra-OH is a bioconjugate used in Click Chemistry. Click Chemistry is a chemical reaction that joins two components together by forming an amide bond between the carboxyl group of one component and the amino group on the other component. Fmoc-Pra-OH was synthesized by reacting the epidermal growth factor (EGF) with a cyclic peptide containing an acid moiety, which was conjugated to the azide group of an azidopropargyl linker. This bioconjugate has been shown to have proliferative activity in vitro and structural studies have been performed to understand its reactivity.