Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30433 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-KLVVVGAVGV^-OH
<p>Peptide H-KLVVVGAVGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HiGom
<p>HiGom is a venom that belongs to the group of proteins that can produce reactive oxygen species. It has been shown to inhibit mitochondrial membrane potential, cellular viability, and the production of reactive oxygen species. HiGom has also been shown to inhibit the production of inflammatory cytokines and chemokines in response to chronic pain. This protein may be useful for cancer treatment as it has been shown to inhibit tumor growth by inducing apoptosis and inhibiting angiogenesis.</p>Formule :C92H150N38O23S4Degré de pureté :Min. 95%Masse moléculaire :2,284.72 g/molH-ILGQQVPYATK^-OH
<p>Peptide H-ILGQQVPYATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Thymosin β 4
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C212H350N56O78SMasse moléculaire :4,963.5 g/molH-YALYDATYETK^-OH
<p>Peptide H-YALYDATYETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLAVYQAGAR^-OH
<p>Peptide H-RLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KDLLEQKRAAVDTYC-NH2
<p>Peptide H-KDLLEQKRAAVDTYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Myelin Oligodendrocyte Glycoprotein(35-55), rat MOG(35-55)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C118H177N35O29SMasse moléculaire :2,582 g/molGlucagon-Like Peptide I (7-36), amide, human
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C149H226N40O45Masse moléculaire :3,297.7 g/molH-CPSSHSSLTERHKILHRLLQEGSPS-NH2
<p>Peptide H-CPSSHSSLTERHKILHRLLQEGSPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YYY-OH
<p>Peptide H-YYY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Val-Ile-Leu
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C17H33N3O4Masse moléculaire :343.46 g/mol[Arg8]-Vasopressin
CAS :<p>Arginine vasopressin (AVP) is an anti-diuretic peptide. It regulates extracellular fluid volume and electrolyte homeostasis.</p>Formule :C46H65N15O12S2Masse moléculaire :1,084.23 g/molH-GISYGRQ^LG^KK^KHRR^RAHQ-OH
<p>Peptide H-GISYGRQ^LG^KK^KHRR^RAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>TAPI-2
<p>Peptide TAPI-2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSLFEYQK^-OH
<p>Peptide H-NSLFEYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSCSSWLDKECVY^FCHLDIIW^VNTPEQTAPYGL^GNPP-OH
<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>G-R-G-E-S-P (Inactive control)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C23H39N9O10Masse moléculaire :601.61 g/molH-SHGQDYLVGNK^-OH
<p>Peptide H-SHGQDYLVGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
![[Arg8]-Vasopressin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50241.webp&w=3840&q=75)
