Peptides

<p>Peptide H-FALPQYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-PQNLLLDPDTAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Ac-Leu-Leu-Met-H (Aldehyde) is a tetrazolium dye that is used as a biological stain for the detection of bacteria in infectious diseases. It binds to toll-like receptor 4 on macrophages and other cells, which triggers a cascade of events leading to bacterial cell lysis. Aldehyde also has been shown to be an autophagy inducer and can cause neuronal death when administered in high doses.</p>

<p>Peptide H-LDELLQSQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LDLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CGRP (Rat) product with the disulfide Bonds: Cys2-Cys7 and available as a 0.1 mg vial. CGRP is the calcitonin gene-related peptide (CGRP), a neuropeptide that plays an important role in the regulation of vascular tone and blood flow, as well as pain perception, inflammation, and neurogenic inflammation. It is a potent vasodilator and has been implicated in a wide range of physiological and pathophysiological processes.<br>This product has the potential for use in the study of the physiological and pathological roles of CGRP and to investigate the effects of CGRP on blood vessels, neurons, and other tissues. It has also been used to develop models of migraine headaches and other conditions associated with CGRP dysfunction.</p>

<p>Vasopressin is a peptide antidiuretic hormone, originating from the hypothalamus, that regulates water balance in the body. It is also known as arginine vasopressin or antidiuretic hormone (ADH). The clinical efficacy of vasopressin has been evaluated using in vitro methods on mouse monoclonal antibody production cells, blood sampling, and microdialysis probes for monitoring blood pressure. This product is available in the salt form: Acetate.</p>

<p>(3,5-Difluorophenylacetyl)-Ala-Phg-OtBu is a secretase inhibitor that inhibits the enzyme that cleaves amyloid precursor protein (APP) to release beta-amyloid. It has been shown to prevent the formation of plaques in the brain and may be used to treat Alzheimer's disease. (3,5-Difluorophenylacetyl)-Ala-Phg-OtBu has also been shown to inhibit the production of tumor necrosis factor alpha (TNFα), which is involved in inflammation and carcinogenesis. The drug has been shown to reduce myocardial infarct size by preventing cardiac cell death and reducing inflammation following a heart attack. It is also active against multiple types of cancer cells, including carcinoma cell lines and multidrug resistant cells.</p>

<p>Ac-Leu-Leu-Nle-H (Aldehyde) is a Toll-like receptor ligand that is active against bowel disease. Aldehyde has been shown to have chemotherapeutic effects in vitro and in vivo, even at low doses. It also inhibits the growth of certain cancer cells by inducing apoptosis, which may be due to its ability to activate the nuclear factor kappa B/Toll-like receptor pathway. This agent has been shown to bind to DNA, inhibit transcription, and induce programmed cell death. Aldehyde also binds to proteins that are involved in protein synthesis and cell division. These properties make it useful for the treatment of infectious diseases and cancer.</p>

<p>Boc-Lys(Z)-OH is an amino acid that is used as a building block for peptide synthesis. It can be used to synthesize Boc-protected L-amino acids, which are useful in the chemical synthesis of peptides and proteins.</p>

<p>Ac-Nle-Cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, also known as cycloastragenol, is a synthetic cyclic peptide that inhibits the activity of adipose β3 adrenergic receptors, leading to reduced fat accumulation. Cycloastragenol has been shown to inhibit the formation of atherosclerotic lesions in mice and may have antiatherogenic effects. It also has been shown to inhibit tumor growth in some skin cancer models and has immunosuppressive effects.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VLHPLEGAVVIIFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-Ala-Asp-OH is a tetrapeptide that belongs to the group of p2, acidic, magnetic and isomeric haemoglobins. This molecule has been shown to hydrolyze enzymes in red blood cells. H-Ala-Asp-OH also binds to red blood cells and may be involved in the regulation of oxygen transport. The magnetic properties of this molecule have been studied by NMR spectroscopy and X-ray crystallography.</p>

<p>Peptide H-NSQVWLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DPK^PIPGNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>