
Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29874 produits trouvés pour "Peptides"
H-FLANVSTVLTSK^-OH
Peptide H-FLANVSTVLTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CONSENSUS B Tat -03
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,666.9 g/molAtrial natriuretic factor (1-28) trifluoroacetate
CAS :Please enquire for more information about Atrial natriuretic factor (1-28) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C127H203N45O39S3•C2HF3O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :3,194.47 g/molH-GEGTFTSDLSK^-OH
Peptide H-GEGTFTSDLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LYPFTWDAVR^-OH
Peptide H-LYPFTWDAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILGGHLDAK^-OH
Peptide H-ILGGHLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLAIDHLNEDQLR^-OH
Peptide H-VLAIDHLNEDQLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5TAMRA-QEPEPPEPFEYIDD-OH
Peptide 5TAMRA-QEPEPPEPFEYIDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAPEEHPVLLTEAPLNPK^-OH
Peptide H-VAPEEHPVLLTEAPLNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DSGSPNPAR^-OH
Peptide H-DSGSPNPAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[pTyr5] EGFR (988-993)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C31H45N6O17PMasse moléculaire :804.69 g/molDelicious peptide (bovine) trifluoroacetate
CAS :Delicious peptide (bovine) trifluoroacetate is a polymerase chain reaction probe that is complementary to the 3' end of the human insulin gene. When used in a polymerase chain reaction, it amplifies the DNA sequences at the 3' end of the gene. The product of this amplification has been shown to inhibit genetic disorders such as metabolic disorders, iron homeostasis, and leukemia. This agent also inhibits acidic fibroblast proliferation and pluripotent cells. This drug has been shown to have a molecular docking analysis with pharmacological agents and may be helpful in treatments for various diseases.Formule :C34H57N9O16•(C2HF3O2)xDegré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :847.87 g/molH2N-Thr-Pro-Pro-Ala-Pro-Lys-pThr-Pro-Pro-Ser-Ser-G
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C71H115N18O26P1Masse moléculaire :1,672.23 g/molAc-KRFKQDGGWSHWSPWSSC-NH2
Peptide Ac-KRFKQDGGWSHWSPWSSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PIIHFGSDYEDR^-OH
Peptide H-PIIHFGSDYEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-INTVNSNTLPVLR^-OH
Peptide H-INTVNSNTLPVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-KKVAVVRTPPKSPSSAKSR-NH2
Peptide LCBiot-KKVAVVRTPPKSPSSAKSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
