Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29608 produits trouvés pour "Peptides"
H-CCCC-OH
Peptide H-CCCC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formule :C12H22N4O5S4Masse moléculaire :430.59 g/molH-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH
H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-TGESAEFVCK-OH
Peptide H-TGESAEFVCK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPTPNVSVVDLTCR-OH
Peptide H-VPTPNVSVVDLTCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LEKARGSTY-OH
Peptide H-LEKARGSTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSCSSLMDKECVYFCHLDIIW-OH
H-CSCSSLMDKECVYFCHLDIIW-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormule :C109H163N25O32S5Masse moléculaire :2,495.97 g/molH-GTVGGYFLAGR-OH
Peptide H-GTVGGYFLAGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-APENAYQAY-OH
Peptide H-APENAYQAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FPLTNAIK-OH
Peptide H-FPLTNAIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLSSLGLNAV-OH
Peptide H-KLSSLGLNAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQSIQPFISR-OH
Peptide H-GQSIQPFISR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YGLSKGCFGLKLDRIGSMSGLGC-NH2
CAS :H-YGLSKGCFGLKLDRIGSMSGLGC-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormule :C102H166N28O30S3Masse moléculaire :2,360.8 g/molH-QSRGDENRGW-OH
Peptide H-QSRGDENRGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KVDDTFYYV-OH
Peptide H-KVDDTFYYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RCVCRRGVCRCVCTRGFC-OH
H-RCVCRRGVCRCVCTRGFC-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-GCTVCG-OH
Peptide H-GCTVCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PPPPP-OH
Peptide H-PPPPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH
H-EGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-LPPHDITPY-OH
Peptide H-LPPHDITPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KKLITFILKKTREK-OH
Peptide H-KKLITFILKKTREK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
