Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29681 produits trouvés pour "Peptides"
H-QAKHKQRKRLKSSC-OH
Peptide H-QAKHKQRKRLKSSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SCSSCPLSK-OH
Peptide H-SCSSCPLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLPAPITR-OH
Peptide H-DLPAPITR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SESIKKKVL-OH
Peptide H-SESIKKKVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2
H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-NAVEVLKR-OH
Peptide H-NAVEVLKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLWAQCVQL-OH
Peptide H-KLWAQCVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSISIQTEEQIHGK-OH
Peptide H-GSISIQTEEQIHGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TITLEVESSDTIDNVK-OH
Peptide H-TITLEVESSDTIDNVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KRFYGGMWKK-OH
Peptide H-KRFYGGMWKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIVLTQSPATLSLSP-OH
H-EIVLTQSPATLSLSP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-PYV-OH
Peptide H-PYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ETIPLQESTLYTEDR-OH
Peptide H-ETIPLQESTLYTEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RADEEQQQALSSQMGF-OH
H-RADEEQQQALSSQMGF-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-AALEDTLAETEAR-OH
Peptide H-AALEDTLAETEAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGSC-OH
Peptide H-GGSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLDTASTTL-OH
Peptide H-NLDTASTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SESGQFHAF-OH
Peptide H-SESGQFHAF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FYLYDSETK-OH
Peptide H-FYLYDSETK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VWESATPLR-OH
Peptide H-VWESATPLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
