Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30473 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
ZNF21 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF21 antibody, catalog no. 70R-7993</p>Degré de pureté :Min. 95%RAPGEF3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAPGEF3 antibody, catalog no. 70R-4546</p>Degré de pureté :Min. 95%SIX1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIX1 antibody, catalog no. 70R-8276</p>Degré de pureté :Min. 95%PAXIP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PAXIP1 antibody, catalog no. 70R-9091</p>Degré de pureté :Min. 95%RPS7 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPS7 antibody, catalog no. 70R-4990</p>Degré de pureté :Min. 95%TRIM54 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM54 antibody, catalog no. 70R-2647</p>Degré de pureté :Min. 95%MAGEA10 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA10 antibody, catalog no. 70R-3922</p>Degré de pureté :Min. 95%GCNT3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NAT13 antibody, catalog no. 70R-1206</p>Degré de pureté :Min. 95%ING4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ING4 antibody, catalog no. 70R-8945</p>Degré de pureté :Min. 95%BATF2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BATF2 antibody, catalog no. 70R-8759</p>Degré de pureté :Min. 95%CYP11B1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP11B1 antibody, catalog no. 70R-9996</p>Degré de pureté :Min. 95%DBX1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DBX1 antibody, catalog no. 70R-8891</p>Degré de pureté :Min. 95%MAGEA11 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA11 antibody, catalog no. 70R-9920</p>Degré de pureté :Min. 95%ZNF259 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF259 antibody, catalog no. 70R-8256</p>Degré de pureté :Min. 95%PGK1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PGK1 antibody, catalog no. 70R-2755</p>Degré de pureté :Min. 95%PI16 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PI16 antibody, catalog no. 70R-6245</p>Degré de pureté :Min. 95%C16ORF65 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C16orf65 antibody, catalog no. 70R-4265</p>Degré de pureté :Min. 95%MYD88 Blocking Peptide
<p>The MYD88 Blocking Peptide is a highly specialized product in the field of Life Sciences, Peptides, and Biochemicals. This peptide plays a crucial role in inhibiting the TGF-beta pathway, which is involved in various cellular processes such as cell growth, differentiation, and apoptosis. By blocking the activity of MYD88, this peptide effectively neutralizes the effects of TGF-beta and prevents abnormal endothelial growth.</p>Degré de pureté :Min. 95%LDHA Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LDHA antibody, catalog no. 70R-3851</p>Degré de pureté :Min. 95%C22orf31 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C22orf31 antibody, catalog no. 70R-9572</p>Degré de pureté :Min. 95%TRPC4AP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRPC4AP antibody, catalog no. 70R-5845</p>Degré de pureté :Min. 95%UGT3A2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UGT3A2 antibody, catalog no. 70R-1871</p>Degré de pureté :Min. 95%CCDC38 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC38 antibody, catalog no. 70R-3282</p>Degré de pureté :Min. 95%LMAN2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LMAN2 antibody, catalog no. 70R-7315</p>Degré de pureté :Min. 95%Stat5b Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Stat5b antibody, catalog no. 70R-8200</p>Degré de pureté :Min. 95%RAD23B Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAD23B antibody, catalog no. 70R-3307</p>Degré de pureté :Min. 95%KCTD19 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD19 antibody, catalog no. 70R-5057</p>Degré de pureté :Min. 95%RPL9 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPL9 antibody, catalog no. 70R-1401</p>Degré de pureté :Min. 95%VISA Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VISA antibody, catalog no. 70R-6462</p>Degré de pureté :Min. 95%CLEC4M Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLEC4M antibody, catalog no. 70R-8545</p>Degré de pureté :Min. 95%Spinorphin, bovine
<p>Custom research peptide; min purity 95%.</p>Formule :C45H64N8O10Degré de pureté :Min. 95%Masse moléculaire :877.06 g/molCFTR (108-117), Pseudomonas aeruginosa Inhibitor
<p>Custom research peptide; min purity 95%.</p>Formule :C51H77N15O22Degré de pureté :Min. 95%Masse moléculaire :1,252.27 g/mol[Lys1015,1024]- Thrombospondin-1 (1015-1024) (human, bovine, mouse)
<p>Custom research peptide; min purity 95%.</p>Formule :C68H105N17O12SDegré de pureté :Min. 95%Masse moléculaire :1,384.77 g/molHBV core protein (128-140)
<p>Custom research peptide; min purity 95%.</p>Formule :C66H103N17O17Degré de pureté :Min. 95%Masse moléculaire :1,406.64 g/molSecretin, human
<p>Custom research peptide; min purity 95%.</p>Formule :C130H220N44O40Degré de pureté :Min. 95%Masse moléculaire :3,039.47 g/molStresscopin-Related Peptide (6-43) (human)
<p>Custom research peptide; min purity 95%.</p>Formule :C183H324N58O51Degré de pureté :Min. 95%Masse moléculaire :4,152.98 g/molHER2/neu(654-662) GP2
<p>Custom research peptide; min purity 95%.</p>Formule :C42H77N9O11Degré de pureté :Min. 95%Masse moléculaire :884.12 g/molInfluenza NP (147-155)
<p>Custom research peptide; min purity 95%.</p>Formule :C48H82N16O14Degré de pureté :Min. 95%Masse moléculaire :1,107.29 g/molGlycogen Synthase-derived peptide
<p>Custom research peptide; min purity 95%.</p>Formule :C49H92N16O14Degré de pureté :Min. 95%Masse moléculaire :1,129.38 g/molG209-2M; gp100 (209-217)
<p>Custom research peptide; min purity 95%.</p>Formule :C47H74N10O14SDegré de pureté :Min. 95%Masse moléculaire :1,035.24 g/molCRF, humanAntiserum
<p>CRF is a human antibody that is used as a research tool. It has reactivity with cells that are activated by CRF, and binds to the receptor on these cells. CRF is also known as a ligand, which can bind to the receptor and trigger changes in the cell, such as ion channels or protein interactions. CRF is an activator of G-protein coupled receptors.</p>Serum amyloid A Light Tryptic Peptide Standard (4nmol)
<p>Serum Amyloid A Light Tryptic Peptide Standard can be use in protein identification and quantitation studies and level of serum amyloid A are present at a blood concentration of below 3 mg/L in healthy individual. However elevated levels of this protein are found in inflammatory rheumatic diseases, hence making serum amyloid A an excellent biomarker for these types of diseases.</p>Degré de pureté :Min. 95%Noggin Mouse
<p>Noggin Mouse is a protein that is secreted by the mouse brain. It is a member of the transforming growth factor-beta superfamily and is involved in development, cell differentiation, and immune regulation. Noggin Mouse has been shown to inhibit cytokine production by E. coli and other bacterial strains. Noggin Mouse also inhibits the release of proinflammatory cytokines from macrophages and synoviocytes.</p>Degré de pureté :Min. 95%SH2 Domain Ligand (2)
<p>Custom research peptide; min purity 95%.</p>Formule :C66H97N12O24PDegré de pureté :Min. 95%Masse moléculaire :1,473.57 g/molInfluenza NP (482-489)
<p>Custom research peptide; min purity 95%.</p>Formule :C44H55N9O15Degré de pureté :Min. 95%Masse moléculaire :949.98 g/molKemptide
CAS :<p>Custom research peptide; min purity 95%.</p>Formule :C32H61N13O9Degré de pureté :Min. 95%Masse moléculaire :771.92 g/molProtease-Activated Receptor-2, PAR-2 Agonist, amide
<p>Custom research peptide; min purity 95%.</p>Formule :C28H54N8O7Degré de pureté :Min. 95%Masse moléculaire :614.79 g/molH-2kb tetramer peptide - G4
<p>Please enquire for more information about H-2kb tetramer peptide - G4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-2kb tetramer peptide - OVA
CAS :<p>98%. TFA salt. OVA 257-264 (H-2Kb) is an epitope of ovalbumin.</p>MBP (1-11), mouse
<p>Custom research peptide; min purity 95%.</p>Formule :C53H95N21O18Degré de pureté :Min. 95%Masse moléculaire :1,314.48 g/molRK9, p17 Gag (20-28)
<p>Custom research peptide; min purity 95%.</p>Formule :C45H86N18O10Degré de pureté :Min. 95%Masse moléculaire :1,039.3 g/molMuscarinic Toxin 3
<p>A synthetic snake venom peptide, sourced from the Green Mamba, Dendroaspis angusticeps. It can be applied as a specific ligand for Muscarinic Acetylcholine Receptor-4 (M4) and this product is available as a 0.1mg vial with disulfide bonds between Cys3- Cys24, Cys17- Cys42, Cys46- Cys57, and Cys58- Cys63.</p>Formule :C319H489N89O97S8Degré de pureté :Min. 95%Masse moléculaire :7,379.4 g/mol[D-Leu7]-(-)-Ternatin
<p>Ternatin is a type of molecule known as a natural product or secondary metabolite and can be used as a fat accumulation inhibitor against 3T3-L1 adipocytes. Specifically, it is a cyclic peptide isolated from marine sources. Ternatins have been studied for their potential biological activities, including their anticancer properties. These molecules belong to the broader category of natural products, which are compounds derived from living organisms and often possess interesting biological activities that make them of interest for various applications in medicine, agriculture, and other fields.This product comes as a 1mg vial.</p>Degré de pureté :Min. 95%LGALS1 Human
<p>LGALS1 is a cytokine that is secreted by macrophages in response to LPS, IL-1 and TNF. This cytokine has been shown to promote the secretion of inflammatory cytokines, such as IL-6, IL-8 and TNF-α. LGALS1 is also involved in the recruitment of neutrophils and monocytes to sites of inflammation. LGALS1 has been shown to be involved in regulating the expression of proteins that are involved in cell signaling pathways, including NF-κB and MAPK.</p>Degré de pureté :Min. 95%Thymosin β4 (human, bovine, horse, rat)
CAS :<p>Thymosin β4 (human, bovine, horse, rat) is a naturally occurring therapeutic peptide derived from various mammalian sources, including humans, cattle, horses, and rats. It is a member of the β-thymosin family and is ubiquitously expressed in many tissues. The primary mode of action of Thymosin β4 involves its ability to bind actin, thereby facilitating cell motility, angiogenesis, and wound repair. It plays a crucial role in cell migration and the formation of new blood vessels, which is essential for tissue regeneration.The uses and applications of Thymosin β4 are extensive, particularly in fields such as regenerative medicine and ophthalmology, where it is employed to promote healing and tissue repair. It has been investigated for its potential therapeutic effects in conditions such as myocardial infarction, corneal injuries, and chronic wounds due to its regenerative properties. As an endogenous peptide, Thymosin β4’s ability to enhance cellular repair mechanisms makes it a subject of ongoing research to fully elucidate its potential benefits and applications in clinical therapies.</p>Formule :C212H350N56O78SDegré de pureté :Min. 95%Masse moléculaire :4,963.49 g/molHuman Papillomavirus E7 protein (49-57)
<p>Custom research peptide; min purity 95%.</p>Formule :C52H77N15O13Degré de pureté :Min. 95%Masse moléculaire :1,120.29 g/molβ-Amyloid (1-15)
<p>Custom research peptide; min purity 95%.</p>Formule :C78H107N25O27Masse moléculaire :1,826.87 g/mol[Asn1,Val5]-Angiotensin II
<p>Custom research peptide; min purity 95%.</p>Formule :C49H70N14O11Degré de pureté :Min. 95%Masse moléculaire :1,031.19 g/molβ-Amyloid (11- 40)
<p>Custom research peptide; min purity 95%.</p>Formule :C143H228N38O40SDegré de pureté :Min. 95%Masse moléculaire :3,151.71 g/molMART-1 (27-35) (human)
<p>Custom research peptide; min purity 95%.</p>Formule :C37H67N9O11Degré de pureté :Min. 95%Masse moléculaire :814 g/molG-R-G-D-S-P
CAS :<p>Custom research peptide; min purity 95%.</p>Formule :C22H37N9O10Degré de pureté :Min. 95%Masse moléculaire :587.59 g/molSubstance P-Gly-Lys-Arg
<p>Custom research peptide; min purity 95%.</p>Formule :C77H124N24O17SDegré de pureté :Min. 95%Masse moléculaire :1,690.06 g/molHIV-1 tat Protein (47-57)
<p>Custom research peptide; min purity 95%.</p>Formule :C64H118N32O14Degré de pureté :Min. 95%Masse moléculaire :1,559.86 g/mol[D-Trp34]-Neuropeptide Y, human; [D-Trp34]-NPY, human
<p>Custom research peptide; min purity 95%.</p>Formule :C195H287N55O56SDegré de pureté :Min. 95%Masse moléculaire :4,329.8 g/molBiotinyl-ω-Agatoxin IVA
<p>A biotinylated, synthetic spider toxin, which can be used as a reagent for a localization study of the omega-Agatoxin IVA binding site. This product has disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34 and is available as a trifluoroacetate salt and as a 0.1mg vial.</p>Formule :C227H374N70O62S11Degré de pureté :Min. 95%Masse moléculaire :5,428.5 g/molGastric Juice Peptide Fragmentc
<p>Custom research peptide; min purity 95%.</p>Formule :C62H98N16O22Degré de pureté :Min. 95%Masse moléculaire :1,419.56 g/molBradykinin
CAS :<p>Custom research peptide; min purity 95%.</p>Formule :C50H73N15O11Degré de pureté :Min. 95%Masse moléculaire :1,060.22 g/molHIV-1 env Protein gp120 (278- 292) (strains BH10, BH8, HXB2, HXB3, PV22)
<p>Custom research peptide; min purity 95%.</p>Formule :C73H126N26O18Degré de pureté :Min. 95%Masse moléculaire :1,655.98 g/molβ-Amyloid (1-42), human
<p>Custom research peptide; min purity 95%.</p>Formule :C203H311N55O60SDegré de pureté :Min. 95%Masse moléculaire :4,514.1 g/molMastoparan X
<p>Custom research peptide; min purity 95%.</p>Formule :C73H126N20O15SDegré de pureté :Min. 95%Masse moléculaire :1,556.01 g/molLeptin (93-105) (human)
<p>Custom research peptide; min purity 95%.</p>Formule :C64H110N20O23Degré de pureté :Min. 95%Masse moléculaire :1,527.7 g/molVesicular Stomatitis Virus peptide
<p>Custom research peptide; min purity 95%.</p>Formule :C44H66N12O12Degré de pureté :Min. 95%Masse moléculaire :955.09 g/mol[Nle4] a-MSH, amide
<p>Custom research peptide; min purity 95%.</p>Formule :C78H111N21O19Degré de pureté :Min. 95%Masse moléculaire :1,646.88 g/molMage-1 Antigen (161-169), human
<p>Custom research peptide; min purity 95%.</p>Formule :C41H57N11O17Degré de pureté :Min. 95%Masse moléculaire :975.97 g/molCEF4
CAS :<p>Portion of Influenza NP</p>Formule :C53H93N15O13Degré de pureté :Min. 95%Masse moléculaire :1,148.42 g/molgp100 (457-466)
<p>Custom research peptide; min purity 95%.</p>Formule :C47H85N13O15Degré de pureté :Min. 95%Masse moléculaire :1,072.28 g/molHemoglobin (Hb) (64-76)
<p>Custom research peptide; min purity 95%.</p>Formule :C64H109N17O18Degré de pureté :Min. 95%Masse moléculaire :1,404.69 g/molAngiotensin II human
CAS :<p>Custom research peptide; min purity 95%.</p>Formule :C50H71N13O12Degré de pureté :Min. 95%Masse moléculaire :1,046.19 g/molMurine CMV pp 89 (168-176)
<p>Custom research peptide; min purity 95%.</p>Formule :C53H74N12O13SDegré de pureté :Min. 95%Masse moléculaire :1,119.32 g/molAbl Cytosolic Substrate
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C64H101N15O16Degré de pureté :Min. 95%Masse moléculaire :1,336.61 g/molSEQ ID NO:549
<p>Custom research peptide; min purity 95%.</p>Formule :C63H91N13O13Degré de pureté :Min. 95%Masse moléculaire :1,238.51 g/molβ-Neo-Endorphin
<p>Custom research peptide; min purity 95%.</p>Formule :C54H77N13O12Degré de pureté :Min. 95%Masse moléculaire :1,100.3 g/molBradykinin [Des-Arg1]
<p>Custom research peptide; min purity 95%.</p>Formule :C44H61N11O10Degré de pureté :Min. 95%Masse moléculaire :904.04 g/molLaminin A Chain (2091-2108)
<p>Custom research peptide; min purity 95%.</p>Formule :C82H148N31O26SDegré de pureté :Min. 95%Masse moléculaire :2,016.3 g/molHistatin 5
CAS :<p>Custom research peptide; min purity 95%.</p>Formule :C133H195N51O33Degré de pureté :Min. 95%Masse moléculaire :3,036.36 g/molβ- Amyloid (37- 43)
<p>Custom research peptide; min purity 95%.</p>Formule :C27H49N7O9Degré de pureté :Min. 95%Masse moléculaire :615.73 g/molβ-MSH, monkey
CAS :<p>Custom research peptide; min purity 95%.</p>Formule :C98H138N28O29SDegré de pureté :Min. 95%Masse moléculaire :2,204.41 g/molAngiotensin III, human
<p>Custom research peptide; min purity 95%.</p>Formule :C46H66N12O9Degré de pureté :Min. 95%Masse moléculaire :931.1 g/molAngiotensin I/II (3-7)
<p>Custom research peptide; min purity 95%.</p>Formule :C31H45N7O7Degré de pureté :Min. 95%Masse moléculaire :627.75 g/molExperimental Allergic Encephalitogenic Peptide (human)
<p>Custom research peptide; min purity 95%.</p>Formule :C46H64N14O14Degré de pureté :Min. 95%Masse moléculaire :1,037.11 g/mol234 CW
<p>Custom research peptide; min purity 95%.</p>Formule :C41H67N11O14S4Degré de pureté :Min. 95%Masse moléculaire :1,066.3 g/mol[Ala1]-PAR-4 (1-6) amide (mouse)
<p>Custom research peptide; min purity 95%.</p>Formule :C34H48N8O7Degré de pureté :Min. 95%Masse moléculaire :680.81 g/molV5 Epitope Tag
<p>Custom research peptide; min purity 95%.</p>Formule :C64H1081N16O20Degré de pureté :Min. 95%Masse moléculaire :1,421.67 g/mol[Des-Acetyl]-a-MSH
<p>Custom research peptide; min purity 95%.</p>Formule :C75H107N21O18SDegré de pureté :Min. 95%Masse moléculaire :1,622.88 g/molHIV Nef(90-100)
<p>Custom research peptide; min purity 95%.</p>Formule :C55H91N13O16Degré de pureté :Min. 95%Masse moléculaire :1,190.42 g/molβ-Amyloid (1-40), Ultra Pure, TFA
<p>Custom research peptide; min purity 95%.</p>Formule :C194H295N53O58SDegré de pureté :Min. 95%Masse moléculaire :4,329.9 g/molNeurokinin B
<p>Custom research peptide; min purity 95%.</p>Formule :C55H79N13O14S2Degré de pureté :Min. 95%Masse moléculaire :1,210.45 g/molC-Peptide (57-87), human
<p>Custom research peptide; min purity 95%.</p>Formule :C129H211N35O48Degré de pureté :Min. 95%Masse moléculaire :3,020.33 g/molFluM1 A2 (58-66)
<p>Custom research peptide; min purity 95%.</p>Formule :C49H75N9O11Degré de pureté :Min. 95%Masse moléculaire :966.2 g/molExendin 4
CAS :<p>Custom research peptide; min purity 95%.</p>Formule :C184H282N50O60S1Degré de pureté :Min. 95%Masse moléculaire :4,186.03 g/molBombinin-like Peptide (BLP-1)
<p>Custom research peptide; min purity 95%.</p>Formule :C115H194N34O33Degré de pureté :Min. 95%Masse moléculaire :2,581.04 g/molAngiotensin I/II (1-6)
<p>Custom research peptide; min purity 95%.</p>Formule :C36H55N11O10Degré de pureté :Min. 95%Masse moléculaire :801.91 g/molCREBtide
<p>Custom research peptide; min purity 95%.</p>Formule :C73H127N29O18Degré de pureté :Min. 95%Masse moléculaire :1,699.01 g/molIndolicidin
<p>Custom research peptide; min purity 95%.</p>Formule :C100H132N26O13Degré de pureté :Min. 95%Masse moléculaire :1,906.33 g/mol[Asn370] tyrosinase (368-376)
<p>Custom research peptide; min purity 95%.</p>Formule :C42H67N11O15S2Degré de pureté :Min. 95%Masse moléculaire :1,030.19 g/molAmylin (8-37),rat
<p>Custom research peptide; min purity 95%.</p>Formule :C140H227N43O43Degré de pureté :Min. 95%Masse moléculaire :3,200.63 g/mol[Met5,Arg6] Enkephalin-Arg
<p>Custom research peptide; min purity 95%.</p>Formule :C39H59N13O9SDegré de pureté :Min. 95%Masse moléculaire :886.05 g/molAkt Specific Substrate Peptide, Akt/PKB
<p>Custom research peptide; min purity 95%.</p>Formule :C36H59N13O9Degré de pureté :Min. 95%Masse moléculaire :817.95 g/molβ-Amyloid (17-42)
<p>Custom research peptide; min purity 95%.</p>Formule :C119H194N28O33SDegré de pureté :Min. 95%Masse moléculaire :2,577.1 g/molProtein Kinase A Substrate
<p>Custom research peptide; min purity 95%.</p>Formule :C34H64N14O11Degré de pureté :Min. 95%Masse moléculaire :844.97 g/molHBV env (183-191)
<p>Custom research peptide; min purity 95%.</p>Formule :C53H92N12O12Degré de pureté :Min. 95%Masse moléculaire :1,089.4 g/molDynorphin A (1-13), porcine
<p>Custom research peptide; min purity 95%.</p>Formule :C75H126N24O15Degré de pureté :Min. 95%Masse moléculaire :1,603.99 g/molProdynorphin (228-240), porcine
<p>Custom research peptide; min purity 95%.</p>Formule :C74H115N21O17Masse moléculaire :1,570.87 g/molmonoFITC RLN3
<p>MonoFITC RLN3 is a labelled form of relaxin that can be used to measure the clearance of relaxin in tissue culture. It can also be used for quantification and localization of peptide receptors in tissues.</p>Degré de pureté :Min. 95%Amino-dPEG®24-Tris(-dPEG®24- Tris (m-dPEG®24)3)3
<p>Amino-dPEG®24-Tris(-dPEG®24- Tris (m-dPEG®24)3)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®24-Tris(-dPEG®24- Tris (m-dPEG®24)3)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formule :C697H1381N17O340Degré de pureté :Min. 95%Masse moléculaire :15,441.49 g/molDBCO-dPEG®24-MAL
<p>DBCO-dPEG®24-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DBCO-dPEG®24-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Degré de pureté :Min. 95%Masse moléculaire :1,555.8 g/molMouse GIP (Total) ELISA (1ea)
<p>The mouse GIP (Total) ELISA kit is a sandwich enzyme-linked immunosorbent assay for the quantitative measurement of mouse GIP in serum, plasma, and culture media. The kit is designed for the detection of mouse GIP and its cleavage product, GIP(1-42). This assay has been validated with purified mouse GIP and recombinant human GIP.</p>Degré de pureté :Min. 95%Phth-dPEG®12-Tris (-TFP Ester)3
<p>Phth-dPEG®12-Tris (-TFP Ester)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Phth-dPEG®12-Tris (-TFP Ester)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formule :C66H78F12N2O24Degré de pureté :Min. 95%Masse moléculaire :1,511.31 g/molMPS-Acid
CAS :<p>Please enquire for more information about MPS-Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C16H33NO8Degré de pureté :Min. 95%Masse moléculaire :367.44 g/molGuangxitoxin-1E
<p>Guangxitoxin-1E is a research tool that belongs to the class of ion channel activators. It can activate ligand-gated ion channels and voltage-gated ion channels, which are important for the transmission of nerve signals. Guangxitoxin-1E can be used as an antibody for immunohistochemistry or Western blotting to detect protein interactions and to study cell biology. It is also useful as a pharmacological tool for studying peptides, proteins, and life science.</p>Degré de pureté :Min. 95%[Sar1,Thr8]-Angiotensin II
<p>Angiotensin II is a peptide hormone that is part of the renin-angiotensin system. It is an antagonist to the angiotensin I receptor, which leads to vasoconstriction, increased blood pressure, and increased water and salt retention by the kidneys. Angiotensin II also stimulates the release of aldosterone from the adrenal cortex, which increases sodium retention by the kidneys and decreases potassium excretion. The peptide is biologically active at nanomolar concentrations.</p>Formule :C44H69N13O11•2CH3COOH•4H2ODegré de pureté :Min. 95%Masse moléculaire :1,148.27 g/molAmino-dPEG®4-(m-dPEG®24)3
<p>Amino-dPEG®4-(m-dPEG®24)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-(m-dPEG®24)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formule :C136H270N6O66Degré de pureté :Min. 95%Masse moléculaire :3,045.6 g/molAmino-dPEG®12-t-Butyl Ester
<p>Amino-dPEG®12-t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®12-t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formule :C56H100F4O26Degré de pureté :Min. 95%Masse moléculaire :1,265.38 g/molAmyloid β-Protein (Human, 1-40) (Scrambled)
<p>Amyloid beta-Protein (Human, 1-40) (Scrambled) is a peptide that consists of 40 amino acids. It is a fragment of the amyloid precursor protein. Amyloid beta-protein has been found to have many different effects in the body, including receptor binding, ion channel activation and inhibition, and protein interactions. The peptide is also an activator for the high-affinity nicotinic acetylcholine receptor in the brain. This product can be used as a research tool or as an antibody to study amyloid beta protein in cellular biology.</p>Degré de pureté :Min. 95%Azido-PEG3-DYKDDDDK
<p>Azido-PEG3-DYKDDDDK is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>Degré de pureté :Min. 95%Anti Motilin (Dog) Serum
<p>Anti Motilin (Dog) Serum is a fractionated serum that is a potent inhibitor of motilin. It inhibits motilin-induced contractions in the small intestine and colon. The Anti Motilin (Dog) Serum is supplied as a lyophilized powder containing purified fractions of dog serum, which are produced by fractionation on an ion-exchange column. The product contains high purity antibody and peptides with no detectable endotoxin or other microbial contaminants. The Anti Motilin (Dog) Serum is supplied in a volume of 5 mL and has a CAS number of 46887-37-2.</p>Degré de pureté :Min. 95%[Sar1,Ala8]-Angiotensin II
<p>Angiotensin II is a peptide hormone that is part of the renin-angiotensin system. It is used as an antagonist to study the effects of angiotensin in the cardiovascular system. Angiotensin II has been shown to decrease blood pressure by acting on specific receptors that are found on cells in the walls of blood vessels. These receptors cause constriction of these vessels and the release of aldosterone, which increases sodium retention and decreases potassium excretion. This leads to increased blood volume, which results in decreased blood pressure.</p>Formule :C43H67N13O10•CH3COOH•4H2ODegré de pureté :Min. 95%Masse moléculaire :1,058.18 g/molBrBzGCp2
CAS :<p>BrBzGCp2 (p BrBzGSH(Cp)2) is a GLO1 inhibitor with antitumor activities, relieving anxiety, and is useful in researching neurological disorders.</p>Formule :C27H38BrN3O6SDegré de pureté :98.68% - 98.68%Couleur et forme :SolidMasse moléculaire :612.58ATX-II TFA
<p>ATX-II TFA, a specific Na+ channel modulator toxin, is derived from the venom of the sea anemone (Anemonia sulcata).</p>Degré de pureté :98%Couleur et forme :Odour Solidcemadotin free base
CAS :<p>Cemadotin free base(LU103793 free base) is a novel anti-limiting peptide , an analog of Dolastatin 15, a naturally occurring cytotoxic peptide that blocks</p>Formule :C35H56N6O5Degré de pureté :98.70% - 99.64%Couleur et forme :SolidMasse moléculaire :640.86Acetyltrialanine acetate
<p>Acetyltrialanine acetate is the nitrogen source of mutants of Salmonella typhimurium.</p>Formule :C13H23N3O7Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :333.34Argininamide
CAS :<p>Argininamide is used in studies of the physicochemical characteristic of ligand binding DNA aptamers.</p>Formule :C6H15N5ODegré de pureté :98%Couleur et forme :SolidMasse moléculaire :173.22Argiprestocin
CAS :<p>Argiprestocin: antidiuretic, regulates osmolality, neurohypophysial hormone, vasoconstrictor.</p>Formule :C43H67N15O12S2Degré de pureté :99.34%Couleur et forme :SolidMasse moléculaire :1050.22Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS :<p>Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.</p>Formule :C32H50N4O8Degré de pureté :Min. 95%Masse moléculaire :618.76 g/molBoc-Lys(Tfa)-AMC
CAS :<p>Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.</p>Formule :C23H28F3N3O6Degré de pureté :Min. 95%Masse moléculaire :499.48 g/molRetatrutide acetate
CAS :<p>Acetate salt; GLP-1, GIP, and GCGR2 mimic; Obesity research</p>Formule :C221H342N46O68•(C2H4O2)xMasse moléculaire :4,791.38 g/molH-Met-Met-OH
CAS :<p>H-Met-Met-OH is a dietary supplement that has been shown to have a variety of health benefits in animals. It has been shown to increase the production of tnf-α and other fatty acids, which are known to play a role in cellular physiology. H-Met-Met-OH also has the ability to inhibit protein synthesis and this is thought to be due to its transport properties as well as its reaction products. H-Met-Met-OH can be taken orally or given through explants, either orally or by injection.</p>Formule :C10H20N2O3S2Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :280.41 g/molFmoc-Phe-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Fmoc-Glu(OtBu)-Thr(psi(Me,Me)pro)-OH
CAS :<p>Fmoc-glu(otbu)-thr(psi(Me,Me)pro)-OH is a c1-6 alkoxy, expressed, alkenyl, linker, c1-6 alkyl, efficiency, sequence that can be used for peptide synthesis. It is an efficient linker for the synthesis of peptides and has been shown to yield high yields with few side products. The hydroxyl group on the side chain of the amino acid residue provides an additional site for acylation. This product also contains an aralkyl and alkoxy group that can be used in further reactions.</p>Formule :C31H38N2O8Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :566.64 g/molSuc-Leu-Leu-Val-Tyr-pNA
CAS :<p>Please enquire for more information about Suc-Leu-Leu-Val-Tyr-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C36H50N6O10Degré de pureté :Min. 95%Masse moléculaire :726.82 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS :<p>Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C43H47FN4O15Degré de pureté :Min. 95%Masse moléculaire :878.85 g/molH-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
CAS :<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS :<p>Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C45H47FN6O14Degré de pureté :Min. 95%Masse moléculaire :914.89 g/molProcollagen Type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH
CAS :<p>Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH is a tetrapeptide that is the most abundant component of human skin. It has been shown to have biological properties and can be synthesized in vitro. Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH has an absorption maximum at 265 nm, which makes it suitable for use in uv protection creams. It also has a high chemical stability and can be stored for up to two years without degradation. Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH is used as a substrate in cell culture to study protein synthesis and transcription, or polymerase chain reaction, technique. This peptide also inhibits the activity of proteases such as trypsin and chymotrypsin, making</p>Formule :C23H45N7O9Degré de pureté :Min. 95%Couleur et forme :White Off-White PowderMasse moléculaire :563.65 g/mol1,4-Diazabicyclo[2.2.2]octane bis(sulfur dioxide) adduct
CAS :<p>1,4-Diazabicyclo[2.2.2]octane bis(sulfur dioxide) adduct is a catalyst that can be used for the reduction of various functional groups. It is typically used to synthesize aziridines from amines and diazo compounds, or from halides and organometallic reagents. 1,4-Diazabicyclo[2.2.2]octane bis(sulfur dioxide) adduct has been shown to inhibit the production of sulfoxides by sulfide-reducing bacteria such as Desulfovibrio desulfuricans and Desulfobulbus propionicus.</p>Formule :C6H12N2O4S2Degré de pureté :Min. 95%Masse moléculaire :240.3 g/molDisulfide biotin azide
CAS :<p>Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.<br>Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.</p>Formule :C27H48N8O7S3Degré de pureté :Min 95%Masse moléculaire :692.92 g/molδ-Sleep Inducing Peptide trifluoroacetate salt
CAS :<p>Delta-Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu-OH trifluoroacetate salt is a peptide that has been shown to have a hypnotic effect in mice. It was found to increase the time spent on the rotarod and decrease locomotor activity in mice. This drug has also been shown to be hypoglycemic and to modulate transcriptional regulation of fatty acid metabolism. Delta Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly Gly Glu OH trifluoroacetate salt may be useful in treating autoimmune diseases, such as multiple sclerosis, due to its ability to regulate 5HT concentrations.</p>Formule :C35H48N10O15Masse moléculaire :848.81 g/mol(Hyp 3,b-(2-thienyl)-Ala5,Tyr(Me)8-psi(CH2NH)Arg9)-Bradykinin trifluoroacetate salt
CAS :<p>Bradykinin is a peptide hormone that is produced in the body and has various physiological effects, such as vasodilation, bronchoconstriction, and the release of histamine from mast cells. Bradykinin is also used in pharmacological treatments for malignant brain tumors, congestive heart failure, and epidermal growth factor-responsive dermatoses. Bradykinin can be administered intravenously or subcutaneously to treat these conditions. The drug can also be administered intraperitoneally to treat high blood pressure during pregnancy. Bradykinin is an ester of 3-b-(2-thienyl)-Ala5,Tyr(Me)8-psi(CH2NH)Arg9-OH with trifluoroacetic acid. It is synthesized by linking two molecules together through an ester bond. This drug has many beneficial effects on the human body due to its ability to inhibit enzymes that are involved in the production of prostagland</p>Formule :C49H75N15O12SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,098.28 g/molSuccinyl-(Glu9,Ala11·15)-Endothelin-1 (8-21)
CAS :<p>Sovateltide is a peptide that is composed of 21 amino acids. It is an agonist of the endothelin receptors ET A and ET B. Succinyl-(Glu9,Ala11·15)-Endothelin (8,21) Sovateltide has been shown to be neuroprotective in preclinical studies and may have potential as a therapeutic agent for the treatment of radiation damage to the brain.</p>Formule :C86H117N17O27Degré de pureté :Min. 95%Masse moléculaire :1,820.95 g/molTirzepatide acetate
CAS :<p>Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.</p>Degré de pureté :Min. 95%Atorvastatin acid
CAS :<p>Atorvastatin acid is a pharmaceutical compound belonging to the class of statins, which is a synthetic derivative of fungal metabolites. It functions as an HMG-CoA reductase inhibitor, playing a critical role in the cholesterol biosynthesis pathway. By inhibiting this key enzyme, atorvastatin acid effectively reduces the conversion of HMG-CoA to mevalonate, a precursor of cholesterol, thus lowering overall cholesterol levels in the bloodstream.</p>Formule :C33H35FN2O5Degré de pureté :Min. 98 Area-%Couleur et forme :White PowderMasse moléculaire :558.64 g/molFlagellin 22 trifluoroacetate
CAS :<p>Please enquire for more information about Flagellin 22 trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C93H162N32O34•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,728.56 g/molH-D-Arg(Me)-OH acetate salt
CAS :Produit contrôlé<p>H-D-Arg(Me)-OH is a peptide that has been shown to inhibit the proliferation of cancer cells in culture. It inhibits the growth of tumor cells by blocking the activity of the oxytocin receptor, which regulates cell adhesion and migration. The H-D-Arg(Me)-OH acetate salt has also been shown to promote the differentiation of basophilic leukemia cells into normal myeloid cells. This peptide is used as a control for incubated cell cultures, such as liver cells, and can be used to study protein synthesis.</p>Formule :C7H16N4O2Degré de pureté :Min. 95%Masse moléculaire :188.23 g/molBoc-Cys(SO3H)-OH·disodium salt
CAS :<p>Please enquire for more information about Boc-Cys(SO3H)-OH·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C8H13NNa2O7S2Masse moléculaire :345.3 g/molAF-16 trifluoroacetate salt
CAS :<p>AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.</p>Formule :C71H119N25O25SDegré de pureté :Min. 95%Masse moléculaire :1,754.92 g/molH-D-Phe-pip-Arg-pna acetate
CAS :<p>H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.</p>Formule :C27H36N8O5Degré de pureté :Min. 95%Masse moléculaire :552.6 g/molBoc-Gly-Arg-OH
CAS :<p>Please enquire for more information about Boc-Gly-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C13H25N5O5Degré de pureté :Min. 95%Masse moléculaire :331.37 g/molH-Asp-NH2
CAS :<p>H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.</p>Formule :C4H8N2O3Degré de pureté :Min. 95%Masse moléculaire :132.12 g/molIL34 Human, His
<p>IL34 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 260 amino acids (21-242 a.a) and having a molecular mass of 29.6kDa. IL34 is fused to a 38 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.</p>Degré de pureté :Min 85% By Sds-Page.((R)-4-Hydroxy-4-methyl-Orn7)-phalloidin
CAS :<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn7)-phalloidin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C35H49N9O10SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :787.88 g/molZ-D-Phe-Phe-Gly-OH
CAS :<p>Z-D-Phe-Phe-Gly-OH is a lysosomal carboxypeptidase that hydrolyzes peptides at the C terminus of proteins. It has a wide substrate specificity and can hydrolyze Z-D-Phe-Phe-Gly, Z-Arg-Lys, and L-Arg. This enzyme has been shown to have ion exchange chromatography activity. The elution profile for this enzyme on a sephadex G-100 column was found to have an optimum pH of 7.5 and elutes at a salt concentration of 0.5M NaCl. Carboxypeptidases are enzymes that cleave at the C terminus of proteins to produce smaller peptides or amino acids. They are involved in digestion, blood clotting, and cell signaling processes.</p>Formule :C28H29N3O6Degré de pureté :Min. 95%Couleur et forme :White Off-White PowderMasse moléculaire :503.55 g/molH-Arg(NO2)-OBzl p-tosylate salt
CAS :<p>Please enquire for more information about H-Arg(NO2)-OBzl p-tosylate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C13H19N5O4·C7H8O3SDegré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :481.52 g/mol(Lauroyl-Cys-Tyr-Gly(-Glu-Glu-Asn-Val)6-OH)2 (Disulfide bond)
CAS :<p>Please enquire for more information about (Lauroyl-Cys-Tyr-Gly(-Glu-Glu-Asn-Val)6-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C280H428N66O120S2Degré de pureté :Min. 95%Masse moléculaire :6,702.9 g/molGRF (human) acetate salt
CAS :<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formule :C215H358N72O66SDegré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :5,039.65 g/mol(Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat)
CAS :<p>Please enquire for more information about (Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C102H166N28O30S3Degré de pureté :Min. 95%Masse moléculaire :2,360.78 g/molH-Ile-Met-OH
CAS :<p>H-Ile-Met-OH is a cytosolic protein that is found in the cytosolic domain of plant cells. H-Ile-Met-OH is an enzyme that catalyzes the conversion of HMBP to Met, which is an intermediate in the biosynthesis of methionine. The frequency and sequence of H-Ile-Met-OH has been analyzed in animals, plants, and fungi. Bioinformatics studies have shown that H-Ile-Met-OH has a vacuolar function, which can be seen by its sequence similarity to other vacuolar proteins.</p>Formule :C11H22N2O3SDegré de pureté :Min. 95%Masse moléculaire :262.37 g/molDABCYL-TNF-α-EDANS (-4 to +6) (human) trifluoroacetate salt
CAS :<p>DABCYL-TNF-alpha-EDANS (-4 to +6) (human) trifluoroacetate salt is a fine chemical that has been shown to be useful in research. It is a versatile building block for the synthesis of complex compounds and can be used as a reaction component for the synthesis of speciality chemicals. The compound is a high quality reagent, which can be used as an intermediate for the synthesis of other chemical compounds.</p>Formule :C70H104N22O18S·C2HF3O2Degré de pureté :Min. 95%Couleur et forme :Red SolidMasse moléculaire :1,687.8 g/molCJC-1295-no DAC acetate
CAS :<p>CJC-1295-no DAC acetate is a synthetic peptide, which is a modified form of the growth hormone-releasing hormone (GHRH) analog, derived from recombinant sources. Its mode of action involves binding to the growth hormone secretagogue receptor, thereby promoting the release of growth hormone from the anterior pituitary. This mechanism of action facilitates the increase of circulating insulin-like growth factor 1 (IGF-1), enhancing various physiological processes.In scientific research, CJC-1295-no DAC acetate is primarily utilized to study its potential effects on muscle growth, body composition, and overall metabolic function. It is also used to explore its ability to modulate the aging process through growth hormone pathways. Unlike its counterpart with DAC, this variant has a shorter half-life, thus allowing researchers to examine the temporal effects of pulsatile GH release. Furthermore, its applications extend to understanding disorders related to growth hormone deficiencies, contributing valuable insights into therapeutic strategies for such conditions. The peptide serves as an important tool in endocrinology research, providing a platform for studying the complex interactions between hormonal regulation and physiological outcomes.DAC is 'drug affinity complex' and in this peptide works by not having a lysine at the end of the sequence.</p>Formule :C152H252N44O42•(C2H4O2)xDegré de pureté :Min. 95%Masse moléculaire :3,367.9 g/molH-Ile-Glu-OH
CAS :<p>Please enquire for more information about H-Ile-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C11H20N2O5Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :260.29 g/molPC Biotin azide
CAS :<p>This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a photocleavable linker. Captured biomolecules can be efficiently released under mild, reagent-free conditions (irradiation with near-UV, low intensity lamp) and the small molecular fragment (100.7 Da) left on the labelled protein following cleavage.</p>Formule :C35H55N9O12SCouleur et forme :PowderMasse moléculaire :825.93 g/molH-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt
CAS :Produit contrôlé<p>Please enquire for more information about H-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C47H84N18O8Degré de pureté :Min. 95%Masse moléculaire :1,029.29 g/molAc-Arg-Leu-Arg-AMC trifluoroacetate salt
CAS :<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>Formule :C30H46N10O6•C2HF3O2Degré de pureté :Min. 96 Area-%Couleur et forme :PowderMasse moléculaire :756.77 g/molLactoferricin B25
CAS :<p>Lactoferricin B25 is a potent anticancer agent that has shown significant activity in vitro against cancer cell lines. It has been shown to induce apoptosis and autophagy, which are both methods of inducing cell death. Lactoferricin B25 also induces caspase-mediated apoptosis and has been shown to be effective in the treatment of cancer cells in vivo. Lactoferricin B25 binds with high affinity to the cell membrane, which is thought to be responsible for its anticancer activity. The half-maximal inhibitory concentration (IC50) for this compound is about 2 μM, with a concomitant cytotoxic effect at 10 μM. Lactoferricin B25 binds to DNA polymerase, preventing DNA replication and transcription. The binding of lactoferricin B25 to DNA polymerase inhibits the synthesis of RNA from DNA templates by inhibiting the elongation step of transcription.</p>Formule :C141H224N46O29S3Degré de pureté :Min. 90 Area-%Couleur et forme :PowderMasse moléculaire :3,123.78 g/molBand 3 Protein (547-553) (human)
CAS :<p>Please enquire for more information about Band 3 Protein (547-553) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C41H63N11O11Masse moléculaire :886.02 g/molα-Bag Cell Peptide (1-7)
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H67N13O9Masse moléculaire :922.11 g/molSomatostatin-14 (3-14)
<p>Catalogue peptide; min. 95% purity</p>Formule :C71H96N16O17S2Masse moléculaire :1,509.78 g/molBax-BH3L63A
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H129N22O27SMasse moléculaire :1,791.05 g/mol[Lys8,Asn9] Neurotensin LANT-6 (8-13)
<p>Catalogue peptide; min. 95% purity</p>Formule :C36H58N8O9Masse moléculaire :746.91 g/molCalmodulin-Dependent Protein Kinase II (281-309)
<p>Catalogue peptide; min. 95% purity</p>Formule :C146H254N46O39S3Masse moléculaire :3,374.05 g/mol[Phe2]-TRH
<p>Catalogue peptide; min. 95% purity</p>Formule :C19H24N4O4Masse moléculaire :372.44 g/mol[D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14)
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H64N14O10S2Masse moléculaire :1,013.22 g/mol[D-Trp2,7,9]-Substance P
<p>Catalogue peptide; min. 95% purity</p>Formule :C80H109N21O13SMasse moléculaire :1,604.96 g/mol[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)
<p>Catalogue peptide; min. 95% purity</p>Formule :C102H152N26O29Masse moléculaire :2,206.51 g/molAquaporin-2 (254-267), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C69H116N24O22Masse moléculaire :1,633.84 g/mol[Ala3,11,18, Nle7] Endothelin-1, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C109H161N25O29S2Masse moléculaire :2,349.78 g/molβ-Amyloid (22-35)
<p>Catalogue peptide; min. 95% purity</p>Formule :C59H102N16O21SMasse moléculaire :1,403.63 g/molpro-ε-Tx1X/12
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H126N26O16Masse moléculaire :1,539.90 g/molCecropin P1 (porcine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C147H253N46O43Masse moléculaire :3,338.93 g/molEGF Receptor (988-993) (phosphorylated) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C31H46N7O16PMasse moléculaire :804.7 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS :<p>Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C33H36N2O9Degré de pureté :Min. 95%Masse moléculaire :604.65 g/molCDC25C
<p>Catalogue peptide; min. 95% purity</p>Formule :C115H198N40O33SMasse moléculaire :2,701.17 g/molHerpes Virus Inhibitor 1
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H64N10O14Masse moléculaire :920.46 g/molN-α-Benzoyl-L-argininamide
CAS :<p>N-alpha-Benzoyl-L-argininamide is a synthetic compound that is used as an enzyme inhibitor. It binds to the active site of proteases, thereby inhibiting their activity. This drug has been shown to inhibit the activities of phosphodiesterase and phosphatase enzymes in vitro. N-alpha-Benzoyl-L-argininamide also inhibits the proteolytic degradation of hippuric acid and casein in vitro. The binding affinity for this drug is due to its structural similarity with substrates such as glutamate and rhizosphere exudates.</p>Formule :C13H19N5O2Degré de pureté :Min 98%Couleur et forme :White PowderMasse moléculaire :277.32 g/molAc-Arg-Ser-Leu-Lys-AMC trifluoroacetate salt
CAS :<p>Please enquire for more information about Ac-Arg-Ser-Leu-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C33H51N9O8•C2HF3O2Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :815.83 g/molFITC-Tyr-Val-Ala-Asp-OH (Contains FITC isomer I)
CAS :<p>FITC-Tyr-Val-Ala-Asp-OH (Contains FITC isomer I) is a bioactive molecule that has been shown to inhibit the growth of filamentous fungi. This compound binds to the tyrosine kinase, which is an enzyme involved in the regulation of cell division and differentiation. It also inhibits neutrophil recruitment by dectin-1, a protein that recognizes fungal cell walls on neutrophils. The FITC isomer I has been shown to impair macrophages and fungus aspergillus fumigatus infiltration in tissues with impaired immune function.<br>FITC-Tyr-Val-Ala-Asp-OH (Contains FITC isomer I) has also been shown to decrease the production of caspase 1, which activates inflammatory responses and stimulates phagocytic cells.</p>Formule :C42H39N5O12SDegré de pureté :Min. 95%Masse moléculaire :837.85 g/molBiotin-Neuromedin B
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H87N17O14S2Masse moléculaire :1,358.62 g/mol[D-Pro2]-β-Casomorphin (1-5) ,bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C30H37N5O7Masse moléculaire :579.66 g/mol
![[Lys1015,1024]- Thrombospondin-1 (1015-1024) (human, bovine, mouse)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPL16877.webp&w=3840&q=75)
![[D-Leu7]-(-)-Ternatin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FTNN-4464-V.webp&w=3840&q=75)
![[Asn1,Val5]-Angiotensin II](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPA16866.webp&w=3840&q=75)
![[D-Trp34]-Neuropeptide Y, human; [D-Trp34]-NPY, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPD16874.webp&w=3840&q=75)
![[Nle4] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPN16882.webp&w=3840&q=75)
![Bradykinin [Des-Arg1]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPB16924.webp&w=3840&q=75)
![[Ala1]-PAR-4 (1-6) amide (mouse)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPA16865.webp&w=3840&q=75)
![[Des-Acetyl]-a-MSH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPD16872.webp&w=3840&q=75)
![[Asn370] tyrosinase (368-376)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPA16867.webp&w=3840&q=75)
![[Met5,Arg6] Enkephalin-Arg](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPM16879.webp&w=3840&q=75)
![[Sar1,Thr8]-Angiotensin II](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPAN-4102.webp&w=3840&q=75)
![[Sar1,Ala8]-Angiotensin II](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPAN-4035.webp&w=3840&q=75)
![1,4-Diazabicyclo[2.2.2]octane bis(sulfur dioxide) adduct](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFD111193.webp&w=3840&q=75)
![[Lys8,Asn9] Neurotensin LANT-6 (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00542.webp&w=3840&q=75)
![[Phe2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00173.webp&w=3840&q=75)
![[D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00137.webp&w=3840&q=75)
![[D-Trp2,7,9]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00654.webp&w=3840&q=75)
![[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00427.webp&w=3840&q=75)
![[Ala3,11,18, Nle7] Endothelin-1, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00286.webp&w=3840&q=75)
![[D-Pro2]-β-Casomorphin (1-5) ,bovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00843.webp&w=3840&q=75)