Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30473 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Casein Kinase II Receptor Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C52H87N19O24Masse moléculaire :1,362.3 g/molGnT-V (nt38-67)
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H89N13O13SMasse moléculaire :1,159.45 g/molPannexin-1 Fragment (4515)
<p>Catalogue peptide; min. 95% purity</p>Formule :C59H104N22O20Masse moléculaire :1,441.62 g/mol[D-Pro194]-IL-1 β (193-195) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C15H28N4O5Masse moléculaire :344.41 g/molLeucokinin III
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H52N12O13Masse moléculaire :908.9 g/molpro-ε-Tx1X/12
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H126N26O16Masse moléculaire :1,539.90 g/molInsulin-Like Growth Factor II (69-84)
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H124N20O26Masse moléculaire :1,817.9 g/molAc-d-Endorphin (bovine, camel, mouse, ovine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C138H217N35O40SMasse moléculaire :3,038.54 g/molα-Substance IB
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H51N9O7Masse moléculaire :685.82 g/molIntermedin (rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C226H361N75O64S2Masse moléculaire :5,216.99 g/molHepatitis B Virus Receptor Binding Fragment
<p>Catalogue peptide; min. 95% purity</p>Formule :C140H185N35O42Masse moléculaire :3,030.17 g/molNon-Ab Component of Alzheimer's Disease Amyloid
<p>Catalogue peptide; min. 95% purity</p>Formule :C141H235N39O49Masse moléculaire :3,260.68 g/molRcramp
<p>Catalogue peptide; min. 95% purity</p>Formule :C181H302N50O48Masse moléculaire :3,946.73 g/molGastrin Releasing Peptide (1-16), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H121N17O20SMasse moléculaire :1,600.9 g/molBiotin-Neurokinin B
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H87N15O14Masse moléculaire :1,326.53 g/molEGF Receptor Substrate 1
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H100N15O26PMasse moléculaire :1,622.68 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Lys-Lys-Lys-Lys-OH trifluoroacetate salt
CAS :<p>Agonist of toll-like receptors TLR1/2</p>Formule :C81H156N10O13SDegré de pureté :Min. 95%Masse moléculaire :1,510.23 g/mol[Pro34]-Neuropeptide Y, human, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C189H285N55O57SMasse moléculaire :4,271.67 g/molHCV NS4A Protein (22-33) (FDA strain)
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H98N15O14SMasse moléculaire :1,213.54 g/molβ-Amyloid/A4 Protein Precursor (APP) (96-110), analog
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H128N32O19S2Masse moléculaire :1,918.25 g/molHerpes Virus Inhibitor 1
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H64N10O14Masse moléculaire :920.46 g/molTyrosine Protein Kinase JAK 2
<p>Catalogue peptide; min. 95% purity</p>Formule :C88H137N20O31PMasse moléculaire :2,082.18 g/molSH2 Domain Ligand (3)
<p>Catalogue peptide; min. 95% purity</p>Formule :C82H122N15O27PSMasse moléculaire :1,813.03 g/molBiotin-Neuromedin B
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H87N17O14S2Masse moléculaire :1,358.62 g/molInfluenza A NP (366-374)
<p>Catalogue peptide; min. 95% purity</p>Formule :C36H59N11O17S2Masse moléculaire :982.06 g/mol[D-Ala2, DArg6] Dynorphin A, (1-13), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C76H128N24O15Masse moléculaire :1,618.02 g/molIGF-I (30-41)
CAS :<p>Please enquire for more information about IGF-I (30-41) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C51H83N19O19Degré de pureté :Min. 95%Masse moléculaire :1,266.32 g/molAc-VQVD-pNA
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H56N6O13Masse moléculaire :997.08 g/molFMRF amide Molluscan Cardioexcitatory Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C29H42N8O4SMasse moléculaire :598.76 g/molCalcitonin N-Terminal Flanking Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C264H426N74O97SMasse moléculaire :6,220.84 g/molSRC-1 (682-697)
<p>Catalogue peptide; min. 95% purity</p>Formule :C82H142N28O22Masse moléculaire :1,872.22 g/molProtein Kinase C Substrate, Glycogen Synthase (1-8)
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H104N18O15Masse moléculaire :1,269.6 g/molBiotin-[Gln1]-Gastrin I (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C107H140N22O34S2Masse moléculaire :2,342.51 g/molApelin-15 (63-75)
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H119N29O16SMasse moléculaire :1,618.94 g/molPrepro-Atrial Natriuretic Factor (104-116), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H113N21O20Masse moléculaire :1,460.7 g/mol[Lys8]-Vasotocin (free acid)
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H66N12O13S2Masse moléculaire :1,023.21 g/molAc-a-Endorphin
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H122N18O27SMasse moléculaire :1,788.02 g/molSalusin-β
<p>Catalogue peptide; min. 95% purity</p>Formule :C115H176N32O21Masse moléculaire :2,342.89 g/molC. difficile Toxin B (192-207)
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H136N22O29Masse moléculaire :1,882.12 g/molBiotin-ACTH (1-39), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C217H322N58O60SMasse moléculaire :4,767.47 g/molNeurotrophic Factor for Retinal Cholinergic Neurons
<p>Catalogue peptide; min. 95% purity</p>Formule :C53H84N12O16Masse moléculaire :1,145.33 g/molPRRS-RSAB-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C77H102N20O23Masse moléculaire :1,675.79 g/molAc-Amyloid β-Protein (15-20) amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H63N9O8Masse moléculaire :822.03 g/molBiotin-[Tyr0]-Orexin B, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C145H238N48O38S2Masse moléculaire :3,325.86 g/molKetolide resistance Peptide MRFFV
<p>Catalogue peptide; min. 95% purity</p>Formule :C34H50N8O6SMasse moléculaire :698.9 g/molFmoc-N-Me-D-Arg(Mtr)-OH
CAS :<p>Please enquire for more information about Fmoc-N-Me-D-Arg(Mtr)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C32H38N4O7SDegré de pureté :Min. 95%Masse moléculaire :622.73 g/molα-Melanocyte Stimulating Hormone (11-13)(MSHa)
<p>Catalogue peptide; min. 95% purity</p>Formule :C16H31N5O3Masse moléculaire :341.46 g/mol[D-Ala2] Deltorphin I
<p>Catalogue peptide; min. 95% purity</p>Formule :C37H52N8O10Masse moléculaire :768.87 g/molBid BH3
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H127N29O24SMasse moléculaire :1,839.08 g/molCalcitonin, eel
<p>Catalogue peptide; min. 95% purity</p>Formule :C146H241N43O47S2Masse moléculaire :3,414.94 g/mol[Cys0]-GTP-Binding Protein Gsa (28-42)
<p>Catalogue peptide; min. 95% purity</p>Formule :C85H143N30O24SMasse moléculaire :2,001.29 g/molproFIX28
<p>Catalogue peptide; min. 95% purity</p>Formule :C149H235N43O44Masse moléculaire :3,332.80 g/molSomatostatin Tumor Inhibiting Analog
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H70N11O10S2Masse moléculaire :1,097.4 g/molPro-TGF-a
<p>Catalogue peptide; min. 95% purity</p>Formule :C52H87N15O17Masse moléculaire :1,194.4 g/molLytic Peptide, Shiva - 1
<p>Catalogue peptide; min. 95% purity</p>Formule :C155H269N53O39SMasse moléculaire :3,531.27 g/mol[Pyr11]-Amyloid β-Protein (11-40)
<p>Catalogue peptide; min. 95% purity</p>Formule :C143H226N38O39SMasse moléculaire :3,133.71 g/molα-Mating Factor (1-6)
<p>Catalogue peptide; min. 95% purity</p>Formule :C45H59N11O8Masse moléculaire :882.04 g/molMBP (74-85), guinea pig
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H94N20O23Masse moléculaire :1,415.49 g/mol[Pyr3]-Amyloid β-Protein (3-42)
<p>Catalogue peptide; min. 95% purity</p>Formule :C196H299N53O55SMasse moléculaire :4,309.97 g/molBDC 2.5(A)
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H99N19O14SMasse moléculaire :1,342.64 g/molgp120, HIV-1 MN
<p>Catalogue peptide; min. 95% purity</p>Formule :C135H221N45O33Masse moléculaire :3,002.55 g/molBiotin-Phosphorylated MBP (94-102)
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H85N20O15SMasse moléculaire :1,273.41 g/mol[Tyr43] PTH (43-68) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C126H208N42O43Masse moléculaire :2,999.32 g/molAc-Neurotrophin Receptor (368-381) amide (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C69H124N22O19Masse moléculaire :1,565.89 g/molβ-Endorphin (1-5), (16-31), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H173N27O29SMasse moléculaire :2,393.86 g/molHistone H3 (116-136), N15-39
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H197N39O30Masse moléculaire :2,570 g/molGhrelin-[Cys(AF647)] Human
<p>Ghrelin is a peptide hormone mainly produced in the stomach. Ghrelin is involved in several physiological processes, including feeding, lipid accumulation, stress response- anxiety- cardiac performance- immunity and inflammation, taste sensation, reward-seeking behaviour, glucose metabolism and thermogenesis, memory, motivation and learning.Ghrelin exerts its actions by binding the growth hormone secretagogue receptor (GHSR), mainly found in the hypothalamic and mesolimbic brain regions and peripheral organs (adipose tissue, adrenals, and stomach).Ghrelin is produced by the cleavage of the precursor peptide preproghrelin. The attachment of a fatty acid to its serine 3 residue makes a form capable of activating GHSR.Ghrelin is a valuable target for treating conditions such as anorexia, cachexia, sarcopenia, cardiopathy, neurodegenerative disorders, renal and pulmonary disease, gastrointestinal disorders, inflammatory disorders and metabolic syndrome.This ghrelin has a C-terminal AF647, a structural analog to Alexa Fluor 647, a widely used far-red fluorescent dye. Its excitation is ideally suited to 594nm or 633nm. This dye is suited for low abundance targets as it has high initial brightness and a high photostability allowing detection of low abundance peptides.</p>Degré de pureté :Min. 95%Masse moléculaire :4,326.9 g/molAcyl Carrier Protein (65-74) (acid)
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H74N12O16Masse moléculaire :1,063.18 g/molSMCY (950-960) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H85N15O18Masse moléculaire :1,172.31 g/molpp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H109N23O23Masse moléculaire :1,592.74 g/molSALMF amide 2 (S2)
<p>Catalogue peptide; min. 95% purity</p>Formule :C59H82N14O18Masse moléculaire :1,275.4 g/molAllatostatin VII
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H69N13O13SMasse moléculaire :1,044.2 g/molAc-ACTH (1-14), 10-1-12A
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H111N21O21SMasse moléculaire :1,722.96 g/molOrn8, Urotensin II, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H85N13O18S2Masse moléculaire :1,376.60 g/molHPV-E7-N
<p>Catalogue peptide; min. 95% purity</p>Formule :C108H159N23O39S2Masse moléculaire :2,467.72 g/molPDGFRtide
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H76N10O20Masse moléculaire :1,185.26 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
<p>Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MMP Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C45H64N14O11Masse moléculaire :977.1 g/molAdrenomedullin (1-52), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C264H406N80O77S3Masse moléculaire :6,028.72 g/molα-Melanocyte Stimulating Hormone [Acetyl-D-Lys11, D-Val13] (11-13) (MSHa)
<p>Catalogue peptide; min. 95% purity</p>Formule :C18H33N5O4Masse moléculaire :383.49 g/molPACAP-38, amide, frog
<p>Catalogue peptide; min. 95% purity</p>Formule :C204H333N63O53SMasse moléculaire :4,548.38 g/molParallel topology β-Amyloid modified peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C151H211N37O39SMasse moléculaire :3,199.65 g/molIL-8ra (9-29)
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H150N24O38S2Masse moléculaire :2,504.71 g/molAc-β-Endorphin, bovine, camel, ovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H252N42O45SMasse moléculaire :3,479.99 g/molBNP-45 ,rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C213H349N71O65S3Masse moléculaire :5,040.79 g/molδ-Endorphin
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H131N19O27SMasse moléculaire :1,859.14 g/mol[Des-Asp10]Decorsin, Leech
<p>Catalogue peptide; min. 95% purity</p>Formule :C175H272N54O59S6Masse moléculaire :4,268.78 g/molPhosphorylase Kinase b-Subunit Fragment (420-436)
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H130N31O25SMasse moléculaire :1,946.13 g/molIL-8 (-5 to +5)
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H86N14O14Masse moléculaire :1,083.31 g/molAntho-Rwamide I
<p>Catalogue peptide; min. 95% purity</p>Formule :C31H46N10O7Masse moléculaire :670.79 g/molH-Gly-Gly-NH2·HCl
CAS :<p>Gly-Gly-NH2·HCl is a nanosized antibiotic that has been shown to have antibacterial properties. It is activated by long-chain inorganic acids, such as hydrochloric acid, and organic solvents, such as acetone. This compound has an amide group that makes it acidic. The hydrocarbon chain of this molecule may be either short or long.</p>Formule :C4H9N3O2·HClDegré de pureté :Min. 95%Masse moléculaire :167.59 g/mol[D-Ala2,DMet5] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H37N5O7SMasse moléculaire :587.70 g/mol[Arg8]-Vasotocin
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H67N15O12S2Masse moléculaire :1,050.23 g/mol[D-Tyr11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Formule :C78H121N21O20Masse moléculaire :1,673 g/molβ III probe
<p>Catalogue peptide; min. 95% purity</p>Formule :C87H143N27O28S3Masse moléculaire :2,111.45 g/molCecropin P1 (porcine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C147H253N46O43Masse moléculaire :3,338.93 g/molEGF Receptor (988-993) (phosphorylated) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C31H46N7O16PMasse moléculaire :804.7 g/molPrepro TRH (53-74)
<p>Catalogue peptide; min. 95% purity</p>Formule :C118H182N32O32Masse moléculaire :2,560.96 g/mol2B-(A)
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H137N28O28SMasse moléculaire :1,983.23 g/mol[β-Ala8]-Neurokinin A (4-10)
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H56N8O10SMasse moléculaire :781 g/molPep 4AK
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H153N27O19Masse moléculaire :1,809.29 g/molAdrenomedullin (1-12), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C64H100N22O19SMasse moléculaire :1,513.7 g/mol[D-Pro2]-β-Casomorphin (1-5) , bovine, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C30H38N6O6Masse moléculaire :578.7 g/molEndothelin-1 (1-15), amide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C70H109N17O23S5Masse moléculaire :1,717.04 g/molLeptin (138-167) (human)
CAS :<p>Please enquire for more information about Leptin (138-167) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C141H224N37O47S2Degré de pureté :Min. 95%Masse moléculaire :3,253.64 g/mol[D-Trp8,D-Cys14]-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Formule :C76H104N18O19S2Masse moléculaire :1,637.91 g/molγ-2-MSH (41-58), amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H100N22O15SMasse moléculaire :1,569.82 g/mol[D-Ala2,Leu5,Arg6] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H51N9O8Masse moléculaire :725.85 g/mol234 CM
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H69N11O14S3Masse moléculaire :1,048.26 g/mol[Asp5,6,Me-Phe8] Substance P
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H56N8O11SMasse moléculaire :857.00 g/mol[D-Met2,Pro5] Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C30H40N6O6SMasse moléculaire :612.75 g/molMating Factor aSK2
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H106N18O19SMasse moléculaire :1,667.92 g/mol[Tyr0]-Neurokinin B
<p>Catalogue peptide; min. 95% purity</p>Formule :C64H88N14O16S2Masse moléculaire :1,373.63 g/molPrésure. 10. 145-148
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H59N7O12Masse moléculaire :902.02 g/molHBVpol655, HBV polymerase (655-663)
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H75N9O11S2Masse moléculaire :994.28 g/molPAKtide
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H85N19O14Masse moléculaire :1,188.36 g/molCEA Related, TYACFVSNL
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H68N10O14SMasse moléculaire :1,017.17 g/molBiotin-Neurokinin A
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H94N16O16S2Masse moléculaire :1,359.64 g/molCAP-18, rabbit
<p>Catalogue peptide; min. 95% purity</p>Formule :C202H356N64O47Masse moléculaire :4,433.49 g/molβ-Amyloid(1-16), mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C80H116N26O26Masse moléculaire :1,857.98 g/molUru-TK II, Urechistachykinin II
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H66N14O10SMasse moléculaire :983.17 g/molβ-Endorphin (1-27), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C139H217N33O40SMasse moléculaire :3,022.54 g/mol[Tyr5,D-Trp6,8,9,Arg-NH210]-Neurokinin A (4-10)
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H68N14O10Masse moléculaire :1,109.3 g/molPRRS-PQGAB-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H90N16O19Masse moléculaire :1,423.56 g/molP38 (411-425), M. leprae
<p>Catalogue peptide; min. 95% purity</p>Formule :C59H100N16O20Masse moléculaire :1,353.55 g/mol[Ala4]-MBP (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H81N21O17Masse moléculaire :1,236.32 g/molPlatelet-Derived Growth Factor Receptor Substrate 2
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H86N13O22PMasse moléculaire :1,300.36 g/molFibrinopeptide B
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H93N19O25Masse moléculaire :1,552.60 g/molSturgeon F
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H83N13O14SMasse moléculaire :1,254.48 g/molP60c-src Substrate II, Phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H45N6O12PMasse moléculaire :748.8 g/molMMP-7 Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C52H77N17O14Masse moléculaire :1,164.31 g/molBiotin-CRF (human, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C218H358N62O65S3Masse moléculaire :4,983.85 g/mol[Des-Tyr1]-β-Endorphin, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C149H242N38O44SMasse moléculaire :3,301.88 g/molPro-Adrenomedullin N20, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H178N36O26Masse moléculaire :2,444.83 g/molCalcitonin C-terminal Adjacent Peptide, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C82H117N23O27SMasse moléculaire :1,889.05 g/molβ-Lipotropin (1-10), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H66N10O15Masse moléculaire :951.05 g/mol[Leu144]-PLP (139-151), L144-PLP(139-151)
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H105N19O17Masse moléculaire :1,448.70 g/mol[Tyr12]-Somatostatin-28 (1-14)
<p>Catalogue peptide; min. 95% purity</p>Formule :C65H107N23O20SMasse moléculaire :1,562.78 g/molKinase Domain of Insulin Receptor (2)
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H108N19O27PMasse moléculaire :1,702.77 g/molGLP-2 (1-33) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C165H254N44O55SMasse moléculaire :3,766.1 g/molβ-Casomorphin (1-5) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C30H37N5O7Masse moléculaire :579.66 g/molp34cdc2-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H104N16O19Masse moléculaire :1,377.62 g/molGalanin-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C155H237N46O46SMasse moléculaire :3,511.95 g/molF1 Peptide, lobster
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H75N17O11Masse moléculaire :1,066.24 g/molIL-8 Inhibitor
CAS :<p>IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys-Arg-NH2 is a molecule that blocks the receptor for IL-8, a c-c chemokine. This leads to reduced inflammation and decreased activation of cells in the inflammatory process. IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys--Arg--NH2 has been shown to be effective in reducing chronic bronchitis and pancreatitis in animal models. The effective dose for IL 8 inhibitor is not yet known.</p>Formule :C45H66N18O7SDegré de pureté :Min. 95%Masse moléculaire :1,003.19 g/molMARCKS PSD-Derived Peptide, PKC Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C75H122N20O15Masse moléculaire :1,543.93 g/molChorionic Gonadotropin-β(109-119) amide (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H76N16O21SMasse moléculaire :1,269.31 g/molEcdysis-Triggering Hormone (Manduca sexta)
<p>Catalogue peptide; min. 95% purity</p>Formule :C127H206N36O38S3Masse moléculaire :2,941.45 g/molNeuropeptide Y-Lys(Biotin), human, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C199H300N57O60S2Masse moléculaire :4,514.98 g/molEMP-1 (Epithelial Membrane Protein)
<p>Catalogue peptide; min. 95% purity</p>Formule :C94H133N25O26S2Masse moléculaire :2,093.39 g/molBig Gastrin-1, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C176H251N43O53SMasse moléculaire :3,849.30 g/mol[D-Val22, Phe33] Big Endothelin-1 (16-38), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C122H178N32O33Masse moléculaire :2,620.97 g/molβ-Amyloid (18-28)
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H81N13O18Masse moléculaire :1,212.34 g/molβ-Casomorphin (1-4) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H34N4O6Masse moléculaire :522.61 g/molBiotin-Bombesin
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H126N26O21S2Masse moléculaire :1,864.2 g/molSecretin-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C130H220N44O40Masse moléculaire :3,039.4 g/molNeuron Specific Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C161H262N52O51S4Masse moléculaire :3,870.44 g/molLytic Peptide, SB - 37
<p>Catalogue peptide; min. 95% purity</p>Formule :C188H320N54O45SMasse moléculaire :4,088.94 g/molOrcokinin
CAS :<p>Orcokinin H-Asn-Phe-Asp-Glu-Ile-Asp-Arg-Ser-Gly-Phe-Gly-Phe is a peptide that was synthesized in the laboratory. It has been shown to have receptor activity and to stimulate locomotor activity in experimental models. Orcokinin H is a member of the family of peptide hormones that are present in mammals. The peptide sequence contains six amino acids, four of which are hydrophobic and two polar, with a single hydroxyl group. These features make this molecule an excellent candidate for use as a model system for studying amyloid protein aggregation and its physiological function.</p>Formule :C67H92N18O23Degré de pureté :Min. 95%Masse moléculaire :1,517.55 g/molHJ Inhibitor Peptide 2
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H61N13O7SMasse moléculaire :964.16 g/molgp100 (178-187)
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H71N11O14S2Masse moléculaire :1,018.23 g/molp60c-src Substrate I
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H60N8O11Masse moléculaire :877.01 g/mol[Gln144]-PLP (139-151), Q144-PLP(139-151)
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H102N20O18Masse moléculaire :1,463.67 g/molAc-Pepstatin
<p>Catalogue peptide; min. 95% purity</p>Formule :C21H37N5O7Masse moléculaire :471.56 g/molSynaptobrevin-2 (73-79) (human, bovine, mouse, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C32H48N8O14Masse moléculaire :768.78 g/molα-Conotoxin IMI
<p>Catalogue peptide; min. 95% purity</p>Formule :C52H74N20O15S4Masse moléculaire :1,347.58 g/molParathyroid Hormone (70-84), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H118N20O24Masse moléculaire :1,587.79 g/mol[D-Ala2,DLeu5] Enkephalin amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C29H40N6O6Masse moléculaire :568.67 g/mol[Ser25]-PKC (19-31)
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H118N26O17Masse moléculaire :1,559.85 g/mol[Arg3] Substance P
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H98N20O13SMasse moléculaire :1,375.67 g/molAc-5A/5B Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H73N11O18S3Masse moléculaire :1,176.34 g/molHylambatin
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H90N16O19S2Masse moléculaire :1,439.64 g/molWWamide-2
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H65N13O10SMasse moléculaire :992.18 g/molδ (Phospho) Sleep Inducing Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H49N10O18PMasse moléculaire :928.83 g/molHuman CMV Assemblin Protease Substrate (M-site)
<p>Catalogue peptide; min. 95% purity</p>Formule :C52H96N20O16Masse moléculaire :1,257.47 g/molEp-CAM (263-271)
<p>Catalogue peptide; min. 95% purity</p>Formule :C38H70N10O10Masse moléculaire :827.04 g/molSomatostatin-14 (2-9)
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H67N12O10SMasse moléculaire :1,028.23 g/molTACE (ADAM-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C75H115N24O26Masse moléculaire :1,768.91 g/mol[D-Ala2,Met5]-β-Casomorphin (1-5), bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C31H41N5O7SMasse moléculaire :627.78 g/mol[Asn76] PTH (64-84), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C94H163N27O35Masse moléculaire :2,231.51 g/molβ-Amyloid/A4 Protein Precursor (APP) (328-332)
<p>Catalogue peptide; min. 95% purity</p>Formule :C25H47N11O9SMasse moléculaire :677.79 g/mol[D-Arg1,D-Pro2,D-Phe7,D-His9]-Substance P
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H102N20O13SMasse moléculaire :1,427.75 g/mol[D-Pro2]-β-Casomorphin (1-5) ,bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C30H37N5O7Masse moléculaire :579.66 g/molBNP (1-21), Pro (Human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C89H144N28O35Masse moléculaire :2,166.31 g/molβ-Amyloid (15-21)
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H65N9O9Masse moléculaire :852.05 g/mol[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H87N19O14Masse moléculaire :1,298.48 g/mol[Tyr52] PTH (52-84) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C158H262N44O56Masse moléculaire :3,674.02 g/molMelanin Concentrating Hormone, human, mouse, rat MCH, human, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C105H160N30O26S4Masse moléculaire :2,386.83 g/mol[Ala9,10, Lys11,12] Glycogen Synthase (1-12)
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H103N17O16Masse moléculaire :1,270.7 g/mol[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H79N13O17Masse moléculaire :1,182.31 g/mol[Tyr1]-pTH (1-34) (rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C186H295N55O49S2Masse moléculaire :4,149.86 g/molBiotin-Gastrin Releasing Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C140H218N40O33S3Masse moléculaire :3,085.74 g/molHPV-E6-M
<p>Catalogue peptide; min. 95% purity</p>Formule :C111H151N25O37SMasse moléculaire :2,459.64 g/molUrocortin (rat) (free acid)
<p>Catalogue peptide; min. 95% purity</p>Formule :C206H337N61O65Masse moléculaire :4,708.35 g/molα-Dendrotoxin
CAS :<p>Alpha-dendrotoxin is a type of neurotoxin that blocks the voltage-gated sodium channel, which provides the neuron with a steady supply of energy. This toxin is found in the venom of certain snakes and can cause paralysis and death. Alpha-dendrotoxin binds to site 1 on the voltage-gated sodium channel and prevents it from opening. It does this by binding to its receptor, which is located on the inside surface of the cell membrane, thus blocking other ions from entering or leaving the cell. The blockage of ions leads to neuronal function impairment, such as memory loss or muscle paralysis.</p>Formule :C305H472N98O84S6Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :7,048.02 g/molFmoc-Val-Cys(Psi(Dmp,H)pro)-OH
CAS :<p>Please enquire for more information about Fmoc-Val-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C32H34N2O7SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :590.69 g/molγ-3-MSH
<p>Catalogue peptide; min. 95% purity</p>Formule :C126H188N44O37SMasse moléculaire :2,943.17 g/mol
![[D-Pro194]-IL-1 β (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[Pro34]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00912.webp&w=3840&q=75)
![[D-Ala2, DArg6] Dynorphin A, (1-13), porcine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00836.webp&w=3840&q=75)
![Biotin-[Gln1]-Gastrin I (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00106.webp&w=3840&q=75)
![[Lys8]-Vasotocin (free acid)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00301.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[D-Ala2] Deltorphin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00825.webp&w=3840&q=75)
![[Cys0]-GTP-Binding Protein Gsa (28-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00280.webp&w=3840&q=75)
![[Pyr11]-Amyloid β-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[Pyr3]-Amyloid β-Protein (3-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00174.webp&w=3840&q=75)
![[Tyr43] PTH (43-68) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00915.webp&w=3840&q=75)
![Ghrelin-[Cys(AF647)] Human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1110382.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone [Acetyl-D-Lys11, D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00016.webp&w=3840&q=75)
![[Des-Asp10]Decorsin, Leech](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00243.webp&w=3840&q=75)
![[D-Ala2,DMet5] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00835.webp&w=3840&q=75)
![[Arg8]-Vasotocin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00302.webp&w=3840&q=75)
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
![[β-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00348.webp&w=3840&q=75)
![[D-Pro2]-β-Casomorphin (1-5) , bovine, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00842.webp&w=3840&q=75)
![[D-Trp8,D-Cys14]-Somatostatin-14](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00216.webp&w=3840&q=75)
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![[Asp5,6,Me-Phe8] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00320.webp&w=3840&q=75)
![[D-Met2,Pro5] Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00841.webp&w=3840&q=75)
![[Tyr0]-Neurokinin B](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00860.webp&w=3840&q=75)
![[Tyr5,D-Trp6,8,9,Arg-NH210]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00356.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Des-Tyr1]-β-Endorphin, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00420.webp&w=3840&q=75)
![[Leu144]-PLP (139-151), L144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00494.webp&w=3840&q=75)
![[Tyr12]-Somatostatin-28 (1-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00705.webp&w=3840&q=75)
![[D-Val22, Phe33] Big Endothelin-1 (16-38), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00478.webp&w=3840&q=75)
![[Gln144]-PLP (139-151), Q144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00496.webp&w=3840&q=75)
![[D-Ala2,DLeu5] Enkephalin amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00834.webp&w=3840&q=75)
![[Ser25]-PKC (19-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00659.webp&w=3840&q=75)
![[Arg3] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00678.webp&w=3840&q=75)
![[D-Ala2,Met5]-β-Casomorphin (1-5), bovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00832.webp&w=3840&q=75)
![[Asn76] PTH (64-84), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00372.webp&w=3840&q=75)
![[D-Arg1,D-Pro2,D-Phe7,D-His9]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00149.webp&w=3840&q=75)
![[D-Pro2]-β-Casomorphin (1-5) ,bovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00843.webp&w=3840&q=75)
![[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00152.webp&w=3840&q=75)
![[Tyr52] PTH (52-84) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00889.webp&w=3840&q=75)
![[Ala9,10, Lys11,12] Glycogen Synthase (1-12)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00635.webp&w=3840&q=75)
![[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00929.webp&w=3840&q=75)
![[Tyr1]-pTH (1-34) (rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00930.webp&w=3840&q=75)
