Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30318 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Cyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C13H24N4O6S1Masse moléculaire :364.42 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
<p>Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FFEILSPVYR^-OH
<p>Peptide H-FFEILSPVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESTLHLVLRLR^GG-OH
<p>Peptide H-ESTLHLVLRLR^GG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIYETDYYR^-OH
Peptide H-DIYETDYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-19/aa73 - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,775 g/molH-KVLEHVVRV^-OH
<p>Peptide H-KVLEHVVRV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>EBV LMP2 356-364 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-GDVAFVK^-OH
<p>Peptide H-GDVAFVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SL^EDLQL^THNK^-OH
Peptide H-SL^EDLQL^THNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 21
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,758.2 g/molH-NVTGFFQSFK^-OH
<p>Peptide H-NVTGFFQSFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTYIHWVR^-OH
<p>Peptide H-DTYIHWVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Mage-1 Antigen (161-169), human
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C41H57N11O17Masse moléculaire :975.97 g/molMYH9 741-749 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-VIQELGLDK^-OH
<p>Peptide H-VIQELGLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKKKKKWLGSALIGALLPSVVGLFQ-NH2
<p>Peptide H-KKKKKKWLGSALIGALLPSVVGLFQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-SGVGNDLVL-NH2
<p>Peptide Ac-SGVGNDLVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-LSALTPSPSWLKYKAL-NH2
<p>Peptide LCBiot-LSALTPSPSWLKYKAL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQFNEAQLALIR^-OH
<p>Peptide H-EQFNEAQLALIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-PLLA-OH
<p>Peptide Ac-PLLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-EEMQRR^-NH2
<p>Peptide Ac-EEMQRR^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SNLKPFER^-OH
<p>Peptide H-SNLKPFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EFTPPVQAAYQK^-OH
<p>Peptide H-EFTPPVQAAYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRVYIHPF-NH2
<p>Peptide H-DRVYIHPF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pal-LPQDKEYYKVKEP-OH
<p>Peptide Pal-LPQDKEYYKVKEP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLDFTELDVAAEK^-OH
<p>Peptide H-SLDFTELDVAAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLHEYMLDL^-OH
<p>Peptide H-TLHEYMLDL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSFFLYSK^LTVD-OH
Peptide H-GSFFLYSK^LTVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MPSKSASLRHTEAC-NH2
<p>Peptide H-MPSKSASLRHTEAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGGGDLTLGLEPSEEEAPR^-OH
<p>Peptide H-SGGGDLTLGLEPSEEEAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYPWTQR-NTPEGBiot
Peptide H-VYPWTQR-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-REEE-NH2
Peptide H-REEE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CHHHHHH-OH PAB-402-60F
<p>Peptide Ac-CHHHHHH-OH PAB-402-60F is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTVNLTWSR^-OH
Peptide H-GTVNLTWSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVVVGAGCVGK^-OH
<p>Peptide H-LVVVGAGCVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VFFGEGDGIIR^-OH
<p>Peptide H-VFFGEGDGIIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Influenza HA (110-120)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C68H97N15O19Masse moléculaire :1,428.62 g/molH-AVLVDLEPGTMDSVR^-OH
<p>Peptide H-AVLVDLEPGTMDSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSGFGNFDLR^-OH
<p>Peptide H-LSGFGNFDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLGLSLAGK^-OH
<p>Peptide H-LLGLSLAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Lauric Acid-NPSSLFRYLPSD-OH
<p>Peptide Lauric Acid-NPSSLFRYLPSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TTPPV^LDSDGSFFLYSK^-OH
<p>Peptide H-TTPPV^LDSDGSFFLYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPIEDGSGEVVLSR^-OH
<p>Peptide H-IPIEDGSGEVVLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Gelsolin
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPhytochelatin 2 (PC2)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C18H29N5O10S2Masse moléculaire :539.58 g/molH-L^TVL^-OH
<p>Peptide H-L^TVL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CRQIKIWFQNRRMKWKK-NH2
<p>Peptide H-CRQIKIWFQNRRMKWKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-ARTKQTARKSTGGKA-NH2
<p>Peptide Ac-ARTKQTARKSTGGKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-AIIGLMVGGVVIA-OH
<p>Peptide LCBiot-AIIGLMVGGVVIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TIVTTLQDSIR^-OH
<p>Peptide H-TIVTTLQDSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FAQTVMTSR^-OH
<p>Peptide H-FAQTVMTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LRRFSTMPFMFCNINNVCNF-NH2
<p>Peptide H-LRRFSTMPFMFCNINNVCNF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>IDR-1
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C65H118N18O15Masse moléculaire :1,391.76 g/molH-GGEIQPVSVK^-OH
<p>Peptide H-GGEIQPVSVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-AVAGKAGAR-OH
Peptide Ac-AVAGKAGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVV-GGFL-OH
Peptide H-VVV-GGFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Arg-Arg-Arg-Ala-Asp-Asp-Ser-Asp-Asp-Asp-Asp-Asp-OH
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C52H83N21O28Masse moléculaire :1,450.36 g/molH-GDQGPVGR^-OH
<p>Peptide H-GDQGPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-IRYCWLRR-NH2
<p>Peptide Biot-IRYCWLRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-LRRFSTAPFAFIDINDVINF-NH2
Peptide LCBiot-LRRFSTAPFAFIDINDVINF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALFPGDSEIDQLFR^-OH
Peptide H-ALFPGDSEIDQLFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VYSTSVTGSR^-OH
<p>Peptide H-VYSTSVTGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AKTDHGAEIVYKSPVVSGDTSPR^-OH
<p>Peptide H-AKTDHGAEIVYKSPVVSGDTSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RFVFG^T^TPEDILR-OH
<p>Peptide H-RFVFG^T^TPEDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-THLAPYSDELR^-OH
<p>Peptide H-THLAPYSDELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSIMR^-OH
<p>Peptide H-SSIMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Hrk BH3 amide
<p>A peptide derived from the Hrk (Harakiri) protein, which is a pro-apoptotic member of the BH3-only family within the larger Bcl-2 family of proteins. The BH3 domain of Hrk, contained in the Hrk BH3 peptide, is the critical region responsible for promoting apoptosis by interacting with and neutralizing anti-apoptotic proteins like Bcl-2, Bcl-xL, and Mcl-1.The BH3 domain within the Hrk BH3 peptide binds to anti-apoptotic proteins, disrupting their ability to prevent apoptosis. This releases pro-apoptotic proteins like Bax and Bak, allowing them to oligomerize and permeabilize the mitochondrial outer membrane. This leads to the release of cytochrome c and the activation of downstream caspases, which execute cell death.Hrk specifically targets Bcl-xL and Mcl-1 more efficiently than some other BH3-only proteins, making it a potent inducer of apoptosis in cells where these anti-apoptotic proteins are overexpressed, such as in certain cancer cells.</p>H-ALP^AP^IEK^-OH
<p>Peptide H-ALP^AP^IEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HIATNAVLFFGR^-OH
<p>Peptide H-HIATNAVLFFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2
Peptide H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DPLNVLKPR^-OH
<p>Peptide H-DPLNVLKPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLDALDSIK^-OH
Peptide H-VLDALDSIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTAIGGAYNVGR^-OH
Peptide H-GTAIGGAYNVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-M^KVLQEPTCVSDY-OH
<p>Peptide H-M^KVLQEPTCVSDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-DAEFRHDSGYEVHHQ-OH
<p>Peptide LCBiot-DAEFRHDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALPAPIEK^TISK-NH2
Peptide H-ALPAPIEK^TISK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NPANNAAIVLQLPQGTTLPK^-OH
<p>Peptide H-NPANNAAIVLQLPQGTTLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVINASAAIAPK^-OH
Peptide H-SVINASAAIAPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-R^R^-OH
<p>Peptide H-R^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SL^YNTVATL-OH
<p>Peptide H-SL^YNTVATL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-GSGSSRGGSGSGGSGGGGSKL-NH2
Peptide LCBiot-GSGSSRGGSGSGGSGGGGSKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HGEVCPAGW-NH2
<p>Peptide H-HGEVCPAGW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-K^IADYNYKL-OH
<p>Peptide H-K^IADYNYKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGDTLNLNLR^-OH
<p>Peptide H-VGDTLNLNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AQDFVQWL^MNT-OH
<p>Peptide H-AQDFVQWL^MNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-114
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,599.7 g/molAc-YSPWTNF-OH
<p>Peptide Ac-YSPWTNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WLSLLVPFV^-OH
Peptide H-WLSLLVPFV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peptide WE-14
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C72H116N18O24SMasse moléculaire :1,649.9 g/molH-VYI^HP-OH
<p>Peptide H-VYI^HP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASGPGGGAPR^-OH
<p>Peptide H-ASGPGGGAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GP120 - W61D - 26
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,830 g/molH-LTIIPQDPILFSGSLR^-OH
Peptide H-LTIIPQDPILFSGSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GILLP^QK-OH
<p>Peptide H-GILLP^QK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Asp-Met-Arg-Pro-Glu-Ile-Trp-Ile-Ala-Gln-Glu-Leu
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C147H225O41N45S1Masse moléculaire :3,310.7 g/molH-LQVTDSGLYRCVIYHPP-NH2
<p>Peptide H-LQVTDSGLYRCVIYHPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CSDTDSTELASIL-OH
<p>Peptide Ac-CSDTDSTELASIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MOG 37-50
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAc-CDGLKFDLGTPL-NH2
<p>Peptide Ac-CDGLKFDLGTPL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RP^PGF-OH
<p>Peptide H-RP^PGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Recombinant Human Parathyroid Hormone aa7-84/Nitrogen-15
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C381H629N119O115S2Masse moléculaire :8,781.05 g/molH-C-Tat-CEAVSLKPT-OH
<p>Peptide H-C-Tat-CEAVSLKPT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 42 (GLAWTRQQNQWKEPD)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,857 g/molHXB2 gag NO-121/aa481 - 495
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,738 g/molCMVpp65 - 15 (LVSQYTPDSTPCHRG)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,660.8 g/molHIV - 1 MN ENV - 10
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,727 g/molH-AADDTWEPFASGK^-OH
<p>Peptide H-AADDTWEPFASGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VIIYEVNK^-OH
<p>Peptide H-VIIYEVNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 31
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,507.6 g/molH-LLIYSASFLYSGVPSR^-OH
<p>Peptide H-LLIYSASFLYSGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPSWEPFR^-OH
Peptide H-SPSWEPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-NGNNVNGNRNNN-OH
Peptide Biot-NGNNVNGNRNNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyc-RGGLCYCRGRFCVCVGR-NH2
<p>Peptide Cyc-RGGLCYCRGRFCVCVGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Rpf-NH2
<p>Peptide Ac-Rpf-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AETSELHTSLK^-OH
<p>Peptide H-AETSELHTSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDVDQALNR^-OH
<p>Peptide H-LDVDQALNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KFKFKFKF-NH2
<p>Peptide Ac-KFKFKFKF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Activity-Dependent Neurotrophic Factor, ADNF
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C41H74N12O12Masse moléculaire :927.12 g/molPal-RWKFGGFKWR-OH
<p>Peptide Pal-RWKFGGFKWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLWC-NH2
<p>Peptide H-HLWC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-REDEDEIEW-NH2
<p>Peptide H-REDEDEIEW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVVTQF^-OH
Peptide H-TVVTQF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF^-OH
<p>Peptide H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DL^AFPGSGEQV^EK-OH
Peptide H-DL^AFPGSGEQV^EK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-PSKPSKRSFIEDLLFNKV-OH
<p>Peptide LCBiot-PSKPSKRSFIEDLLFNKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSARLAF-NH2
Peptide H-LSARLAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Elpamotide
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C47H76N16O13Masse moléculaire :1,073.2 g/molH-VTEPISAESGEQVER^-OH
Peptide H-VTEPISAESGEQVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGGFL^RRQFKVVT-OH
<p>Peptide H-YGGFL^RRQFKVVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HNLGHGHK^-OH
<p>Peptide H-HNLGHGHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-SPQLATLADEVSASLAKQGL-OH
<p>Peptide Ac-SPQLATLADEVSASLAKQGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Gastrin Releasing Peptide, human
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C130H204N38O31S2Masse moléculaire :2,859.4 g/molNuclear-encoded Humanin [HN(N)] (Rat)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :4,311.08 g/molH-NEALIALLR^-OH
<p>Peptide H-NEALIALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPFPGP^IP^NS-OH
<p>Peptide H-YPFPGP^IP^NS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-I^LGGQE-OH
<p>Peptide H-I^LGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLNSLSEL^EVK-OH
<p>Peptide H-NLNSLSEL^EVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DI^TP^TLTL^YVGK^-OH
<p>Peptide H-DI^TP^TLTL^YVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-QVPLRPMTYK-OH
<p>Peptide Ac-QVPLRPMTYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-A^VLQ-OH
<p>Peptide H-A^VLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSGSSLIR^-OH
<p>Peptide H-DSGSSLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LNFARKRIKNPEGGLC-NH2
Peptide Ac-LNFARKRIKNPEGGLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-YGGFLRRQFKVVT-OH
Peptide Ac-YGGFLRRQFKVVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPDVSSAL^DK-OH
<p>Peptide H-TPDVSSAL^DK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 62 (TLGSDVEEDLTMTRN)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,680.8 g/molAc-Ala-Ala-Ala-NH2
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C11H20O4N4Masse moléculaire :272.3 g/molPPI 2-10 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAc-CEVRRIDLVKRDYSR-NH2 PAB-405-1419A
Peptide Ac-CEVRRIDLVKRDYSR-NH2 PAB-405-1419A is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SLGR-OH
Peptide Ac-SLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GNPARARERLKNIERIC-NH2
<p>Peptide Ac-GNPARARERLKNIERIC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPDAVATWLKPDPSQK^-OH
<p>Peptide H-YPDAVATWLKPDPSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALPASIEK^-OH
<p>Peptide H-ALPASIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ARTKQTARKSTGGKAPRKQLA^-OH
Peptide H-ARTKQTARKSTGGKAPRKQLA^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KGSTAENAEYLRV-NH2
<p>Peptide Ac-KGSTAENAEYLRV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Integrin Ligand peptide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C23H42N10O10·C2HF3O2Masse moléculaire :732.66 g/molH-VGDGTVIL^^K^^-OH
<p>Peptide H-VGDGTVIL^^K^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTQSGSLLFIGR^-OH
<p>Peptide H-DTQSGSLLFIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH
Peptide LCBiot-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVAANIVL^TV-OH
Peptide H-AVAANIVL^TV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTP^P^V^LDSDGSYFLYSK^-OH
Peptide H-TTP^P^V^LDSDGSYFLYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IVEIPFNSTNK^-OH
Peptide H-IVEIPFNSTNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Septin 3
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-TLSDYNIQK^ESTLHLVLR^-OH
<p>Peptide H-TLSDYNIQK^ESTLHLVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 197
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,976.3 g/molH-AGEVQEPELR^-OH
<p>Peptide H-AGEVQEPELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATEIIEPSK^-OH
Peptide H-ATEIIEPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLSALQAVQGLLVAQGR^-OH
<p>Peptide H-VLSALQAVQGLLVAQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVAVSQVAR^-OH
<p>Peptide H-SVAVSQVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-29
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,554.6 g/molCMVpp65 - 43 (TRQQNQWKEPDVYYT)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,956.1 g/molH-GILTVDELLAIR^-OH
<p>Peptide H-GILTVDELLAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-I^DAL^NENK-OH
<p>Peptide H-I^DAL^NENK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 31 (LNIPSINVHHYPSAA)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,632.8 g/molH-NAVPITPTLNR^-OH
<p>Peptide H-NAVPITPTLNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Thr-Ala-Ile
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C13H25N3O5Masse moléculaire :303.35 g/molAc-KIFMK-NH2
<p>Peptide Ac-KIFMK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVQVHQDTLR^-OH
<p>Peptide H-AVQVHQDTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLGDFFR^-OH
Peptide H-LLGDFFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-L^TVDK-OH
Peptide H-L^TVDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GHPEPLDLHLGMFLPTLLHQATEEQQER^-OH
<p>Peptide H-GHPEPLDLHLGMFLPTLLHQATEEQQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Masse moléculaire :3,247.64 g/molH-FGAVYSSDEAL^IPIR-OH
<p>Peptide H-FGAVYSSDEAL^IPIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYAEVNSLR^-OH
<p>Peptide H-VYAEVNSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLFGYPVYV^-OH
<p>Peptide H-LLFGYPVYV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MGKKQNRKTGNSKTC-NH2
<p>Peptide H-MGKKQNRKTGNSKTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Val-Ile-Phe
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C20H31N3O4Masse moléculaire :377.48 g/molH-QGVAEAAGK^-OH
Peptide H-QGVAEAAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TDEGIAYR^-OH
<p>Peptide H-TDEGIAYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSPIYNLVPVK^-OH
Peptide H-LSPIYNLVPVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HHHHHHC-NH2
<p>Peptide H-HHHHHHC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 88 (FFFDIDLLLQRGPQY)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,872.2 g/molH-VHLTP^EEKSAVTAL-OH
Peptide H-VHLTP^EEKSAVTAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TFTLLDPK^-OH
<p>Peptide H-TFTLLDPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVLLNAIYLSAK^-OH
<p>Peptide H-LVLLNAIYLSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-THLAPYSDEL^R-OH
<p>Peptide H-THLAPYSDEL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GNLLINIR^-OH
<p>Peptide H-GNLLINIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FESSAAKLKRKYWWK^NLK^-OH
<p>Peptide H-FESSAAKLKRKYWWK^NLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>proFIX18
<p>Peptide proFIX18 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C95H157N31O27Masse moléculaire :2,165.5 g/molAc-CDDLIKVVEELTRIH-OH
Peptide Ac-CDDLIKVVEELTRIH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![Nuclear-encoded Humanin [HN(N)] (Rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50491.webp&w=3840&q=75)
