Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30318 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
β-Amyloid (4-10)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C39H52N12O12Masse moléculaire :880.92 g/molH-Glu-Glu-Leu-OH
CAS :H-Glu-Glu-Leu-OH is a vitamin that is essential for the production of hydroxyproline, which aids in the formation of collagen. It is also used to treat osteoarthritis and rheumatoid arthritis. H-Glu-Glu-Leu-OH is synthesized from glutamate, glutamic acid, and leucine in the liver and kidney. This reaction proceeds by two steps: first, glutamate carboxylase converts glutamate to α-ketoglutarate; then, aspartate aminotransferase converts α-ketoglutarate to aspartate semialdehyde. Aspartate semialdehyde is converted to H-Glu-Glu-Leu by an enzyme called glutamyl aminopeptidase. The reaction mechanism of this enzyme has been studied experimentally and theoretically using sodium bicarbonate (NaHCO) as a buffer. The sequential natureFormule :C16H27N3O8Degré de pureté :Min. 95%Couleur et forme :White Off-White PowderMasse moléculaire :389.40 g/molBiot-QEQLERALNSS-OH
<p>Peptide Biot-QEQLERALNSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 57 (KVYLESFCEDVPSGK)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,700.9 g/molH-VGYMHWYQQKPGK^-OH
<p>Peptide H-VGYMHWYQQKPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVNELIYK^-OH
<p>Peptide H-SVNELIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-V^YIHPFHL-OH
<p>Peptide H-V^YIHPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Neuropeptide-Like Protein 12 (NLP-12) (33-39) (54-60) amide (C. elegans)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :937.05 g/molFmoc-Cys-OH
Peptide Fmoc-Cys-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VNLLSAIK^-OH
<p>Peptide H-VNLLSAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Asp(Lys-OH)-OH
CAS :<p>H-Asp(Lys-OH)-OH is a metabolite that is an intermediate in the fatty acid oxidation pathway. It may be involved in the progression of colorectal carcinoma by inhibition of fatty acid synthesis, leading to the accumulation of fatty acids and subsequent death. This metabolite can also be used to identify potential biomarkers for colorectal cancer. H-Asp(Lys-OH)-OH can be detected using liquid chromatography coupled with mass spectrometry (LC/MS).</p>Formule :C10H19N3O5Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :261.28 g/molH-GFYFNKPTGYGSSSR^-OH
<p>Peptide H-GFYFNKPTGYGSSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Kisspeptin 234
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C63H78N18O13Masse moléculaire :1,295.42 g/molSIVmac239 - 92
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,565.9 g/molH-LYL^VCGERGF-OH
<p>Peptide H-LYL^VCGERGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTVEDPVTVEYITR^-OH
<p>Peptide H-LTVEDPVTVEYITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATFQTPDFIVPLTDLR^-OH
Peptide H-ATFQTPDFIVPLTDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ATEII^EPSK-OH
<p>Peptide H-ATEII^EPSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Ala-Asp-OH
CAS :H-Ala-Asp-OH is a tetrapeptide that belongs to the group of p2, acidic, magnetic and isomeric haemoglobins. This molecule has been shown to hydrolyze enzymes in red blood cells. H-Ala-Asp-OH also binds to red blood cells and may be involved in the regulation of oxygen transport. The magnetic properties of this molecule have been studied by NMR spectroscopy and X-ray crystallography.Formule :C7H12N2O5Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :204.18 g/molAc-AKFVAAWTLKA-NH2
Peptide Ac-AKFVAAWTLKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.rec FGF acidic (human)
CAS :<p>Please enquire for more information about rec FGF acidic (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%H-STSGGTAALGCLVK^-OH
Peptide H-STSGGTAALGCLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-VVVVVVD-OH
<p>Peptide Ac-VVVVVVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VDSALYLGSR^-OH
<p>Peptide H-VDSALYLGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>1-Adamantanecarbonyl-Arg-Phe-NH2
<p>Peptide 1-Adamantanecarbonyl-Arg-Phe-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FGVAPDHPEVK^-OH
Peptide H-FGVAPDHPEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GK^GDPK^K^PR-OH
Peptide H-GK^GDPK^K^PR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^V^GGLV^ALR^-OH
<p>Peptide H-V^V^GGLV^ALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-117
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,611.8 g/molAc-CRSRGPSQAEREGPG-NH2
<p>Peptide Ac-CRSRGPSQAEREGPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Ser-His-OH acetate
CAS :H-Ser-His-OH acetate salt is an amide that has been shown to have a neutral pH and to be soluble in organic solvents such as chloroform. It has a biological function of being a serine protease inhibitor. H-Ser-His-OH acetate salt binds to the amino acid histidine and inhibits the activity of serine proteases. This product has been used in fluorescence techniques, immunofluorescence analyses, and molecular biology.Formule :C9H14N4O4·xC2H4O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :242.24 g/molAc-NNNN-NH2
Peptide Ac-NNNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHGLEIEGR^-OH
<p>Peptide H-VHGLEIEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APLQGTLLGYR^-OH
<p>Peptide H-APLQGTLLGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KDILEDERAAVDTYC-NH2
<p>Peptide H-KDILEDERAAVDTYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 48 (PTKDVALRHVVCAHE)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,675 g/molH-ATVVYQ^GER-OH
<p>Peptide H-ATVVYQ^GER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-ISPLKSPYKISEGLC-NH2
<p>Peptide Ac-ISPLKSPYKISEGLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Annexin A1(1-25)(dephosphorylated)(human)ammonium salt
CAS :<p>Annexin A1 is a phospholipid-binding protein that is involved in the regulation of inflammation. It is often found in atherosclerotic lesions and has been shown to be an anti-inflammatory cytokine. Annexin A1 (dephosphorylated) does not inhibit the activity of enzymes such as cyclooxygenase and lipoxygenase, and so it may have therapeutic potential for treatment of autoimmune diseases such as Crohn's disease or bowel disease. Annexin A1 also has anti-inflammatory properties, which may be due to its ability to inhibit the production of proinflammatory cytokines such as IL-6 and TNF-α by inhibiting the activation of NFκB.</p>Formule :C141H210N32O44S·NH4Degré de pureté :Min. 97 Area-%Couleur et forme :White PowderMasse moléculaire :3,107.47 g/molBrAc-TWPKHFDKHTFYSILKLGKH-NH2
<p>Peptide BrAc-TWPKHFDKHTFYSILKLGKH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Masse moléculaire :2,604.86 g/molH-DRVYI^HPFHLVI-OH
<p>Peptide H-DRVYI^HPFHLVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Kpy-NH2
<p>Peptide Ac-Kpy-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 8 (RGDTPVLPHETRLLQ)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,732 g/molBQ-788 Sodium Salt
CAS :BQ-788 is a sodium salt that has high resistance to corrosion. It is effective in wastewater treatment, as it can be used as a coagulant and flocculant. BQ-788 is an electrochemical impedance spectroscopy (EIS) active ingredient that has been shown to have good thermodynamic data. This chemical substance also displays optimum concentration at 6 mM in sulfuric acid and crystalline cellulose, with a solubility of 2.5% at room temperature. The EIS measurements were performed on the locomotor activity of rats with metabolic disorders, which led to the conclusion that BQ-788 is an important factor for locomotor activity through its effects on the central nervous system and peripheral nervous system.Formule :C34H50N5O7NaDegré de pureté :Min. 95%Masse moléculaire :663.8 g/molH-QLLAPGNSAGAFLIR^-OH
Peptide H-QLLAPGNSAGAFLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CAEAETAKDN-OH
Peptide Ac-CAEAETAKDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GEGIEEFLR^-OH
<p>Peptide H-GEGIEEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLGYLEQLLR^-OH
<p>Peptide H-YLGYLEQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-QDGNEEMGGITQTPYKVSISGTTVILT-NH2
<p>Peptide LCBiot-QDGNEEMGGITQTPYKVSISGTTVILT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYFAVLM-NH2
<p>Peptide H-TYFAVLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 60
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,715.9 g/molLCBiot-YGGFLRRIRPKLK-OH
<p>Peptide LCBiot-YGGFLRRIRPKLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVDVEEQQLEESGPHDLTETSYLPR^-OH
<p>Peptide H-VVDVEEQQLEESGPHDLTETSYLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPEGVPPLLVSQQAK^-OH
<p>Peptide H-DPEGVPPLLVSQQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 3
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,740 g/molH-Glu(Edans)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(Dabcyl)-OH
<p>H-Glu(Edans)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(Dabcyl)-OH is a peptide and biochemical that belongs to the group of enzyme substrates. It is a nonapeptide that contains an amidated lysine residue at the N terminus and the sequence H-Glu(Edans)-Pro-Leu is repeated. The amidated lysine residue facilitates the attachment of H-Glu(Edans)-Pro-Leu to an enzyme substrate, in this case calpain. H-Glu(Edans)-Pro-Leu binds to calpain by forming a covalent bond with a reactive cysteine residue on the enzyme's active site, thereby inhibiting its activity.</p>Formule :C72H97N17O16SDegré de pureté :Min. 95%Masse moléculaire :1,488.74 g/mol(4S)-4-[[(2S)-3-Carboxy-2-[[(2S,3R)-2-[[(2R)-2-[[(2S,3S)-2-[[(2S)-3-carboxy-2-[[(2R)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-sulfanylp ropanoyl]amino]propanoyl]amino]-3-methylpentanoyl]amino]-3-sulfanylpropanoyl]amino]-3-hydroxybutanoyl]amino]propanoyl]amin
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C44H68N10O18S2Masse moléculaire :1,089.2 g/molPal-KVK-OH
Peptide Pal-KVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLDDLK^^-OH
<p>Peptide H-HLDDLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CDDYYYGFGCNKFGRPRDD-NH2
<p>Peptide Ac-CDDYYYGFGCNKFGRPRDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DALSSVQESQVAQQ^AR-OH
<p>Peptide H-DALSSVQESQVAQQ^AR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVLDSGISEVR^-OH
Peptide H-TVLDSGISEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.rec Oncostatin M (human)
CAS :<p>Please enquire for more information about rec Oncostatin M (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%H-VITKPFTK^-OH
Peptide H-VITKPFTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-S^LSLSLG-OH
<p>Peptide H-S^LSLSLG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YWGVASFLQK^-OH
Peptide H-YWGVASFLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ITDFGLAK^-OH
<p>Peptide H-ITDFGLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Z-Gly-Met-OH
CAS :<p>Z-Gly-Met-OH is a buffer that can be used to create an acidic solution. It is often used in liquid chromatography and peptide synthesis. Z-Gly-Met-OH has been shown to have potential use as an enzyme inhibitor, specifically for proteases and peptidases. The hydrolyzed form of Z-Gly-Met-OH has been shown to bind zinc ions and could be used in the treatment of metal ion poisoning.</p>Formule :C15H20N2O5SDegré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :340.4 g/molH-EITFHGAK^-OH
<p>Peptide H-EITFHGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-KKLNRTLSFAEPG-NH2
Peptide Biot-KKLNRTLSFAEPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neuropeptide Y (free acid) (human)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C189H284N54O58S1Masse moléculaire :4,272.8 g/molAc-DDTSRMEEVD-OH
Peptide Ac-DDTSRMEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Abz-APEEIMRRQ-EDDnp
<p>Peptide Abz-APEEIMRRQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5TAMRA-DPIYALSWSGMA-OH
<p>Peptide 5TAMRA-DPIYALSWSGMA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-V^IFDANAPVAVR^-OH
Peptide H-V^IFDANAPVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 53 (ENTRATKMQVIGDQY)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,754 g/molH-VLGAFSDGLAHLDNLK^^-OH
<p>Peptide H-VLGAFSDGLAHLDNLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-WAKW-NH2
<p>Peptide Ac-WAKW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ala-Asp-Ser-Asp-Pro-Arg
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C25H41N9O12Masse moléculaire :659.65 g/molH-Glu(Tyr-OH)-OH
CAS :<p>H-Glu(Tyr-OH)-OH is an amino acid analogue that has been shown to have natriuretic effects. It also has anti-inflammatory and analgesic properties, which are likely due to its ability to inhibit the bacterial enzyme arginase. H-Glu(Tyr-OH)-OH is a part of a class of compounds called oximes, which are used in the treatment of poisoning by organophosphates, pyrethroid insecticides, and carbamates. The compound is synthesized by treating L-glutamic acid with hydrogen peroxide and tyrosine in acidic conditions. H-Glu(Tyr-OH)-OH has also been found to have a protective effect on alcohol induced damage in rats. This may be due to its ability to increase the synthesis of dopamine, which is involved in the regulation of blood pressure and water balance.</p>Formule :C14H18N2O6Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :310.3 g/molFor-MAIVGTIIKIIKAIIDIFAK-OH
Peptide For-MAIVGTIIKIIKAIIDIFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALEI-NH2
<p>Peptide H-ALEI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQIVYKPVDLSK^-OH
Peptide H-VQIVYKPVDLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVEAFGGATK^-OH
Peptide H-LVEAFGGATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQNDTSQTSSPS-Phosphocolamine
Peptide H-GQNDTSQTSSPS-Phosphocolamine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KRFKQDGGWSHWSPWSSC-NH2
<p>Peptide Ac-KRFKQDGGWSHWSPWSSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Ile-Glu-Pro-Asp-AMC
CAS :<p>AMC conjugated molecule targeting caspase-8 and granzyme B</p>Formule :C32H41N5O11Degré de pureté :Min. 97 Area-%Couleur et forme :PowderMasse moléculaire :671.7 g/molSIVmac239 - 53
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,703.8 g/molDelicious peptide (bovine) trifluoroacetate
CAS :Delicious peptide (bovine) trifluoroacetate is a polymerase chain reaction probe that is complementary to the 3' end of the human insulin gene. When used in a polymerase chain reaction, it amplifies the DNA sequences at the 3' end of the gene. The product of this amplification has been shown to inhibit genetic disorders such as metabolic disorders, iron homeostasis, and leukemia. This agent also inhibits acidic fibroblast proliferation and pluripotent cells. This drug has been shown to have a molecular docking analysis with pharmacological agents and may be helpful in treatments for various diseases.Formule :C34H57N9O16•(C2HF3O2)xDegré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :847.87 g/molH-SSDTEENVK^-OH
<p>Peptide H-SSDTEENVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ARV^YIHPF-OH
<p>Peptide H-ARV^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-RGGGGLGLGK-NH2
Peptide Ac-RGGGGLGLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YYQQLK^-OH
<p>Peptide H-YYQQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQVYSR^-OH
<p>Peptide H-IQVYSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-SDKNEKSHKYETLNISKC-NH2
<p>Peptide Ac-SDKNEKSHKYETLNISKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSSHPIFHR^-OH
Peptide H-SSSHPIFHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSLFFFPLPLLIK^-OH
Peptide H-GSLFFFPLPLLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GEGQQHHLGGAKQAGDV-OH
<p>Peptide Ac-GEGQQHHLGGAKQAGDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLANVSTVLTSK^-OH
<p>Peptide H-FLANVSTVLTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVASGVVVVAAAGNEGTSGGSSTVGYPGK^-OH
<p>Peptide H-AVASGVVVVAAAGNEGTSGGSSTVGYPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Boc-Gln-Gly-Arg-AMC·HCl
CAS :<p>Boc-Gln-Gly-Arg-AMC·HCl is a reagent that is used as a reaction component in the synthesis of peptides, antibiotics, and other complex compounds. Boc-Gln-Gly-Arg-AMC·HCl is also a useful scaffold for the synthesis of new fine chemicals. This chemical has a CAS number of 133448-21-2, and is classified as a speciality chemical and versatile building block. It can be used to synthesize various fine chemicals with high purity and quality.</p>Formule :C28H40N8O8·HClDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :653.13 g/molH-GFYPSDIAVEWESNGQPENNYK^-OH
Peptide H-GFYPSDIAVEWESNGQPENNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-REEE-NH2
<p>Peptide Ac-REEE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GIQLVEEELDR^-OH
Peptide H-GIQLVEEELDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYGIPFIETSAK^-OH
<p>Peptide H-SYGIPFIETSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PrEST Antigen TAS2R39
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :21 g/molH-VTFSNIK^-OH
<p>Peptide H-VTFSNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>FA-Gly-Leu-Ala-OH TFA
CAS :<p>FA-Gly-Leu-Ala-OH TFA is a high quality reagent that can be used for the synthesis of complex compounds. It is an intermediate for the production of fine chemicals and speciality chemicals, which are used as reaction components in the synthesis of versatile building blocks. This compound is also an excellent scaffold for research chemicals and useful as a building block in the synthesis of speciality chemicals.</p>Formule :C18H25N3O6•TFADegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :493.43 g/molH-GAVVGVGDESR^-OH
<p>Peptide H-GAVVGVGDESR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPSVF^PL^APSSK^-OH
Peptide H-GPSVF^PL^APSSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPSTPPTPSPSTPPTPSPSC-NH2
Peptide H-VPSTPPTPSPSTPPTPSPSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HyNic-GLFHAIAHFIHGGWHGLIHGWYG-OH
<p>Peptide HyNic-GLFHAIAHFIHGGWHGLIHGWYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLIYY^TSR^-OH
<p>Peptide H-LLIYY^TSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GDLGIEIPAEK^-OH
<p>Peptide H-GDLGIEIPAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-S^LS^LSPGK^-OH
Peptide H-S^LS^LSPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Angiotensin I (1-9)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C56H78N16O13Masse moléculaire :1,183.35 g/molAzide-IELLQARC-OH
Peptide Azide-IELLQARC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-WEDWVGWI-NH2
Peptide Ac-WEDWVGWI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Thr(tBu)-2-ClTrt-Resin (200-400 mesh) 1% DVB
<p>H-Thr(tBu)-2-ClTrt-Resin is an amine resin that is used as a building block for the synthesis of peptides. It is used in conjunction with other resins and chemicals to produce a wide variety of peptides. The resin contains 1% DVB, which improves the solubility and stability of the resin. This product can be used in a variety of applications, including peptide synthesis, protein sequencing, and antibody production.</p>Degré de pureté :Min. 95%Myr-KFEEERARAKWDT-OH
<p>Peptide Myr-KFEEERARAKWDT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FQPTLLTLPR^-OH
<p>Peptide H-FQPTLLTLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DVINEAWFPEDQR^-OH
<p>Peptide H-DVINEAWFPEDQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 106
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,688 g/molHepcidin-25 (human) trifluoroacetate salt
CAS :Please enquire for more information about Hepcidin-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C113H170N34O31S9·C2HF3O2Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :2,903.38 g/molH-GDVTAQIALQPALK^-OH
<p>Peptide H-GDVTAQIALQPALK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Env 57-71
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-GLSPTVWLSV^-OH
<p>Peptide H-GLSPTVWLSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GELNEHLGLLGPYIR^-OH
Peptide H-GELNEHLGLLGPYIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ITLYLK^-OH
<p>Peptide H-ITLYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>β-Amyloid (1-38)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C184H277N51O56SMasse moléculaire :4,131.6 g/molH-WLQGSQELPR^-OH
<p>Peptide H-WLQGSQELPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QKSDDDYEDYASNKTC-NH2
<p>Peptide H-QKSDDDYEDYASNKTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-MYWVRQAPGKGLEW-NH2
<p>Peptide Ac-MYWVRQAPGKGLEW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CEF-29 CMV pp65 (123-131)
<p>Portion of CMV pp65</p>Degré de pureté :Min. 95%Masse moléculaire :1,079.2 g/molH-VVAAVGDAVK^-OH
<p>Peptide H-VVAAVGDAVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CLAVYQAGAR^-OH
Peptide H-CLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-R^LITGRLQSL-OH
Peptide H-R^LITGRLQSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGFLHSGTAK^-OH
<p>Peptide H-LGFLHSGTAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-ERGVT-OH
Peptide Biot-ERGVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IIPGGIYDADLNDEWVQR^-OH
Peptide H-IIPGGIYDADLNDEWVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSSDVDQLGK^-OH
<p>Peptide H-GSSDVDQLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASNTAEVFFDGVR^-OH
Peptide H-ASNTAEVFFDGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-PVKRRLDL-OH
<p>Peptide Biot-PVKRRLDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLQGLPR^-OH
<p>Peptide H-VLQGLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Gly-Leu-Gly-OH
CAS :Gly-Leu-Gly is a peptide that has a conformation in which the side chain of the amino acid glycine is attached to the alpha-carbon atom of the amino acid leucine. It is a labile molecule, meaning that it can react with other molecules or break down spontaneously. Gly-Leu-Gly is also called glycylleucine. This peptide has been found to have protonation properties that depend on temperature and kinetic energy. The carbonyl group of this peptide interacts with other molecules by donating or accepting electrons. In addition, this compound can be analyzed using spectrometers and gas chromatographs.Formule :C10H19N3O4Masse moléculaire :245.28 g/molFluor-ENPVVHFFKNIVTPR-OH
Peptide Fluor-ENPVVHFFKNIVTPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SSVSDYVNYDIIVR^-OH
Peptide H-SSVSDYVNYDIIVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVEEVSLR^-OH
Peptide H-AVEEVSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.B-Ahx-AEEEYFFLFA-NH2
<p>Peptide B-Ahx-AEEEYFFLFA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Leu-Tyr-OH
CAS :H-Leu-Tyr-OH is a biphasic response amide with two phenyl groups and a primary amino group. It is most active at pH 6.5, but can be used at higher or lower pHs. The rate of H-Leu-Tyr-OH formation is highest in triticum aestivum (wheat) butyric acid extract. H-Leu-Tyr-OH has been shown to have excitatory effects on plant physiology, which may be due to its ability to bind to the specific antibody against acetylcholine receptors.Formule :C15H22N2O4Masse moléculaire :294.35 g/molH-VHVGDEDFVHLR^-OH
<p>Peptide H-VHVGDEDFVHLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SANILLDEAF^TAK-OH
<p>Peptide H-SANILLDEAF^TAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SARS-CoV-2 Antigen Peptide NCAP (TWLTYTGAIKLDDKDPNF)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C97H144N22O30Masse moléculaire :2,098.43 g/molH-TKQTAR^^-OH
<p>Peptide H-TKQTAR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KPVSLSYRCPCR^FFE-OH
<p>Peptide H-KPVSLSYRCPCR^FFE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HBV polymerase (455-463)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C46H79N15O12Masse moléculaire :1,034.24 g/molH-IAPQLSTEELVSLGEK^-OH
<p>Peptide H-IAPQLSTEELVSLGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-VPMLK-OH
<p>Peptide Fluor-VPMLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELVSEFSR^-OH
<p>Peptide H-ELVSEFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IALILEPICCQERAA-OH
<p>Peptide H-IALILEPICCQERAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C71H123N19O21S2Masse moléculaire :1,642.98 g/molH-GAGSSEPVTGLDAK^-OH
Peptide H-GAGSSEPVTGLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AFYLAGGVPR^-OH
<p>Peptide H-AFYLAGGVPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVINGNPITIFQER^-OH
<p>Peptide H-LVINGNPITIFQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-108
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,765.1 g/molH-DAEFR^HDSGYEVHHQ-OH
<p>Peptide H-DAEFR^HDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-SIINFEKLGSGHWDFAWPW-OH
<p>Peptide Fluor-SIINFEKLGSGHWDFAWPW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-PGP-OH
<p>Peptide Ac-PGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Nesfatin-1 (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Nesfatin-1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C427H691N113O134Degré de pureté :Min. 95%Masse moléculaire :9,551.74 g/molH-VLNDILSR^L-OH
<p>Peptide H-VLNDILSR^L-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Larazotide
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C32H55N9O10Masse moléculaire :725.83 g/molH-IILEALR^-OH
<p>Peptide H-IILEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RR^-OH
Peptide H-RR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PAR-3 (1-6) amide (human)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C29H46N10O7Masse moléculaire :646.75 g/molH-GTFIIDPGGVIR^-OH
<p>Peptide H-GTFIIDPGGVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPLTNAIK^-OH
<p>Peptide H-FPLTNAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STDTAYMELSSLR^-OH
Peptide H-STDTAYMELSSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Asp(Ala-OH)-OH
CAS :H-Asp(Ala-OH)-OH is an amino acid that has been found to be selectively active in the cerebral cortex. It has a high affinity for the cerebral cortex, with a Kd of 1.5 nM and a brain tissue concentration of 3.3 µg/g. H-Asp(Ala-OH)-OH has been shown to have neuroprotective effects against hypoxia, glutamate toxicity, and oxygen deprivation. This compound reverses the effects of oxidative stress in cultured cells and can also stimulate protein synthesis in cultured cells. The mechanism by which it works is not yet known but may involve inhibition of cysteine uptake into the cell or stimulation of protein synthesis by increasing intracellular levels of cAMP.Formule :C7H12N2O5Degré de pureté :Min. 95 Area-%Couleur et forme :White PowderMasse moléculaire :204.18 g/molH-TWNDPSVQQDI^K^-OH
Peptide H-TWNDPSVQQDI^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVL^VQREKDL^PNYNWNSFGL^RF-NH2
<p>H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formule :C258H401N79O78Masse moléculaire :5,857.5 g/molH-SELEEQLTPVAEETR^-OH
Peptide H-SELEEQLTPVAEETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TANDLNLLILR^-OH
<p>Peptide H-TANDLNLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DGVPVIK^-OH
Peptide H-DGVPVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QTISNACGTIGLIHAIANNK^-OH
Peptide H-QTISNACGTIGLIHAIANNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISTLNSLTLPALR^-OH
Peptide H-ISTLNSLTLPALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YMLDL^QPETT-OH
<p>Peptide H-YMLDL^QPETT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DANISQPETTK^-OH
Peptide H-DANISQPETTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HEAWITLEK^-OH
Peptide H-HEAWITLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-82/aa325 - 339
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,554.8 g/molH-IRPFF^PQ-OH
<p>Peptide H-IRPFF^PQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-SGRGKGGKGLGKGGAKRHRKV-NH2
<p>Peptide LCBiot-SGRGKGGKGLGKGGAKRHRKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GFQALGDAADIR^-OH
Peptide H-GFQALGDAADIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGDTSLDPNDFDFTVTGR^-OH
Peptide H-VGDTSLDPNDFDFTVTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Gly-Phe-AMC
CAS :H-Gly-Phe-AMC is a synthetic substrate that is used in homogeneous enzyme assays. This product has been shown to have inhibitory properties against proteolytic enzymes such as peptidases, which are enzymes that break down proteins. H-Gly-Phe-AMC is also reactive with collagen and has been shown to be useful in the study of biochemical properties of peptide hormones.Formule :C21H21N3O4Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :379.41 g/molH-LDAQASFLPK^-OH
<p>Peptide H-LDAQASFLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTVGGYFL^AGR^-OH
Peptide H-GTVGGYFL^AGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tertiapin
CAS :<p>Tertiapin is a synthetic bee venom peptide (Honey Bee, Apis mellifera) containing disulfide bonds between Cys3-Cys14 and Cys5-Cys18. It is an inward rectifier K+ channel blocker and also blocks the activity of calcium activated large conductance potassium channels. The pain and inflammation symptoms experienced after a bee sting is caused by this peptide even though bee venom also has the potential to treat pain and inflammation in conditions such as rheumatoid arthritis and multiple sclerosis.</p>Formule :C106H180N34O23S5Degré de pureté :Min. 95%Masse moléculaire :2,459.11 g/molH-QTALVELVK^-OH
<p>Peptide H-QTALVELVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FALPQYLK^-OH
<p>Peptide H-FALPQYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C49H74N10O11Masse moléculaire :979.18 g/molH-GIYQTSNFR^-OH
Peptide H-GIYQTSNFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PQNLLLDPDTAVLK^-OH
<p>Peptide H-PQNLLLDPDTAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
