Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30318 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
SIVmac239 - 104
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,697.1 g/molVitamin D Receptor (VDR)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-GTGNLELVAVR^-OH
<p>Peptide H-GTGNLELVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Parathyroid Hormone (PTH) (Active)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Biot-QYIKANSKFIGITEL-OH
<p>Peptide Biot-QYIKANSKFIGITEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Tyrosinase precursor (1-9)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-ISTLNSHNLPILR^-OH
Peptide H-ISTLNSHNLPILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-FLEAIG-NH2
Peptide Ac-FLEAIG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Trp63,Trp64)-C3a (63-77)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C86H134N26O18Masse moléculaire :1,820.17 g/molSIVmac239 - 35
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,621.9 g/molH-GFFYTPK^-OH
<p>Peptide H-GFFYTPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KIQMK-NH2
<p>Peptide Ac-KIQMK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>pHLIP WT
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :4,525.87 g/molH-QVSDLISVLR^-OH
Peptide H-QVSDLISVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVFVDLEPTVIDEVR^-OH
Peptide H-AVFVDLEPTVIDEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EDALNETR^-OH
Peptide H-EDALNETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTPPVL^DSDGSF^FLYSR-OH
<p>Peptide H-TTPPVL^DSDGSF^FLYSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LAQGAYRTAVDLESLASQLT-NH2
<p>Peptide Ac-LAQGAYRTAVDLESLASQLT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-KKRNRTLTK-NH2
<p>Peptide Biot-KKRNRTLTK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-DAEFRHDSGYEVHHQ-OH
<p>Peptide LCBiot-DAEFRHDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Mal-LYLVCGERG-OH
<p>Peptide Mal-LYLVCGERG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALPAPIEK^TISK-NH2
Peptide H-ALPAPIEK^TISK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGYLLPDTK^-OH
<p>Peptide H-SGYLLPDTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NPANNAAIVLQLPQGTTLPK^-OH
<p>Peptide H-NPANNAAIVLQLPQGTTLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-31/aa121 - 135
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,658.8 g/molH-GLEWVSK^-OH
Peptide H-GLEWVSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NNPFYFPSR^-OH
Peptide H-NNPFYFPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELAFNLPSR^-OH
<p>Peptide H-ELAFNLPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMV pp65
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C72H118N18O18Masse moléculaire :1,523.8 g/molH-DIYKGVYQFKSV-OH
<p>LCMV CD4 epitope peptide GP66–77 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C69H103N15O19Masse moléculaire :1,446.65 g/molAc-KVPRNQDWL-OH
<p>Peptide Ac-KVPRNQDWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VDLLNQEIEFLK^-OH
Peptide H-VDLLNQEIEFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.NAP
Peptide NAP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formule :C36H60N10O12Masse moléculaire :824.94 g/molAc-PCH-NH2
Peptide Ac-PCH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVAGVANALAHK^^-OH
<p>Peptide H-VVAGVANALAHK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ-OH
<p>Peptide H-ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALDNLAR^-OH
<p>Peptide H-ALDNLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAYPLSIEPIGVR^-OH
<p>Peptide H-GAYPLSIEPIGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLTLHLK^-OH
Peptide H-GLTLHLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Proadrenomedullin N-terminal 20 Peptide (Human, 9-20)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C77H119N25O14Masse moléculaire :1,618.95 g/molH-TYSKPFHPK^-OH
<p>Peptide H-TYSKPFHPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GALQNIIPASTGAAK^-OH
<p>Peptide H-GALQNIIPASTGAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GP120 - W61D - 54
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,704.1 g/molFluor-NLVPMVATV-OH
Peptide Fluor-NLVPMVATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NL^VPMVATV-OH
<p>Peptide H-NL^VPMVATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Ala-2-ClTrt-Resin (100-200 mesh) 1% DVB
<p>For preparation of acids, alcohols, thiols, or amines</p>Degré de pureté :Min. 95%H-FALNAANAR^-OH
Peptide H-FALNAANAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CSIVDSGTTN-OH
Peptide Ac-CSIVDSGTTN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-PRCGVPDL-NH2
<p>Peptide Ac-PRCGVPDL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-NNN-NH2
<p>Peptide Ac-NNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>D-form LS-sarcotoxin
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C185H317N59O52Masse moléculaire :4,199.84 g/molH-LFDQAFGVPR^-OH
<p>Peptide H-LFDQAFGVPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FITLVPSNLPHEATR^-OH
Peptide H-FITLVPSNLPHEATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^IFDANAPVAVR-OH
<p>Peptide H-V^IFDANAPVAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Laminin (925-933)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C40H62N12O14SMasse moléculaire :967.1 g/molH-NQEKVSPLTLLKLGN-NH2
<p>Peptide H-NQEKVSPLTLLKLGN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VFSLQWGEVK^-OH
<p>Peptide H-VFSLQWGEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 25
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,859.1 g/molH-EIAQDFK^-OH
Peptide H-EIAQDFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tyr-CRF (human, rat)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C217H353N61O65S2Masse moléculaire :4,920.73 g/molH-TWLV^PDSR-OH
<p>Peptide H-TWLV^PDSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5Fam-RHKK-OH
<p>Peptide 5Fam-RHKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-MEEVD-OH
<p>Peptide Ac-MEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-IHIHIYI-NH2
<p>Peptide Ac-IHIHIYI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GALALAQAVQR^-OH
Peptide H-GALALAQAVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-HEHRKRG-OH
Peptide Fluor-HEHRKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLRPGGKKK^-OH
<p>Peptide H-RLRPGGKKK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGFIEGHVVIPR^-OH
<p>Peptide H-YGFIEGHVVIPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Nesfatin-1 Like Peptide (Mouse)
<p>Nesfatin-1 Like Peptide (Mouse) is a peptide that regulates feeding behavior and insulin secretion. It is an insulinotropic peptide, which means it stimulates the release of insulin from pancreatic beta cells. Nesfatin-1 Like Peptide (Mouse) has been shown to be upregulated in the hypothalamus during fasting, thereby regulating feeding behavior. This peptide also has neurologic effects, such as stimulating locomotor activity, and may have antiinflammatory effects.</p>Formule :C382H599N107O128Degré de pureté :Min. 95%Masse moléculaire :8,738.67 g/molgp100 (476 - 485)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C57H83N13O15Masse moléculaire :1,190.38 g/molSIVmac239 - 68
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,750.1 g/molH2N-Glu-Phe-Lys-His-Ile-Lys-Ala-Phe-Asp-Arg-Thr-Ph
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C139H208N36O36S2Masse moléculaire :3,023.49 g/molMyr-FTEIPTI-OH
Peptide Myr-FTEIPTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IADFGLAR^-OH
Peptide H-IADFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-Y-OH
<p>Peptide Fluor-Y-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SAFPTTINF^-OH
<p>Peptide H-SAFPTTINF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AMHVAQPAVVLASSR^-OH
<p>Peptide H-AMHVAQPAVVLASSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CKKPQITTEPHAT-OH
<p>Peptide Ac-CKKPQITTEPHAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALKPGVIQILGVK^-OH
<p>Peptide H-ALKPGVIQILGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGVAGQWR^-OH
<p>Peptide H-LGVAGQWR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLYSFPEP^EA-OH
Peptide H-SLYSFPEP^EA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GNQWVGYDDQESVK^-OH
Peptide H-GNQWVGYDDQESVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPKMV^QGSGCFGRKMDRISSSSGLGCK^VLRRH-OH
<p>Peptide H-SPKMV^QGSGCFGRKMDRISSSSGLGCK^VLRRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CDDRHDSGLDSMKDEE-NH2
<p>Peptide H-CDDRHDSGLDSMKDEE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVQIAAVVDVIR^-OH
<p>Peptide H-TVQIAAVVDVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IECFDSVEISGVEDR^-OH
Peptide H-IECFDSVEISGVEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALDNLAR^^-OH
Peptide H-ALDNLAR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-F^F^-OH
<p>Peptide H-F^F^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Mastoparan A
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C79H138N20O16Masse moléculaire :1,624 g/molH-LTIIPQDPILFSGSLR^-OH
Peptide H-LTIIPQDPILFSGSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MVLASTTAK^-OH
<p>Peptide H-MVLASTTAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>[Des-Arg9]-Bradykinin
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C44H61N11O10Masse moléculaire :904.04 g/molH-GILLP^QK-OH
<p>Peptide H-GILLP^QK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Asp-Met-Arg-Pro-Glu-Ile-Trp-Ile-Ala-Gln-Glu-Leu
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C147H225O41N45S1Masse moléculaire :3,310.7 g/molH-LQVTDSGLYRCVIYHPP-NH2
<p>Peptide H-LQVTDSGLYRCVIYHPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGDFGLATVK^-OH
<p>Peptide H-IGDFGLATVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CSDTDSTELASIL-OH
<p>Peptide Ac-CSDTDSTELASIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fmoc-Ile-Rink-Amide MBHA Resin
<p>Fmoc-Ile-Rink-Amide MBHA Resin is a resin that is used in the synthesis of peptides. It is composed of amino acid building blocks, which are connected to form polymers. The resin is insoluble in water and organic solvents, which makes it suitable for use in peptide synthesis and other applications. Fmoc-Ile-Rink-Amide MBHA Resin can be used as an alternative to polystyrene and polypropylene resins because it has a higher loading capacity and is more stable at high temperatures.</p>Degré de pureté :Min. 95%H-EPISVSSEQVLK^-OH
Peptide H-EPISVSSEQVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-FSPDDSAGASALLR-OH
<p>Peptide LCBiot-FSPDDSAGASALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTQLGTFEDHFLSLQR^-OH
<p>Peptide H-LTQLGTFEDHFLSLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGGFLRRIR^PKLK-OH
<p>Peptide H-YGGFLRRIR^PKLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DDLYVSDAFHK^-OH
<p>Peptide H-DDLYVSDAFHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGKPAPDFK^-OH
<p>Peptide H-IGKPAPDFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DAVTYTEHAK^-OH
<p>Peptide H-DAVTYTEHAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGNEIQYVALR^-OH
<p>Peptide H-VGNEIQYVALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fmoc-Arg(Pbf)-Rink-Amide MBHA Resin
FMOC-Arg(Pbf)-Rink-Amide MBHA Resin is a research tool used in cell biology and pharmacology. It is an activator of ion channels and a ligand for receptors. This resin is used to study protein interactions, antibody specificity, and peptide binding properties. The resin can be used as an inhibitor of the phosphorylation of proteins in cells. FMOC-Arg(Pbf)-Rink-Amide MBHA Resin has been shown to be useful in pharmacology for the treatment of various diseases such as diabetes and hypertension.Degré de pureté :Min. 95%MOG 37-50
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-YLEPGPVTV^-OH
<p>Peptide H-YLEPGPVTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CDGLKFDLGTPL-NH2
<p>Peptide Ac-CDGLKFDLGTPL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RP^PGF-OH
<p>Peptide H-RP^PGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Recombinant Human Parathyroid Hormone aa7-84/Nitrogen-15
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C381H629N119O115S2Masse moléculaire :8,781.05 g/molAnoga-HrTH hormone
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C47H64N10O11Masse moléculaire :945.07 g/molH-C-Tat-CEAVSLKPT-OH
<p>Peptide H-C-Tat-CEAVSLKPT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 42 (GLAWTRQQNQWKEPD)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,857 g/molHXB2 gag NO-121/aa481 - 495
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,738 g/molH-GIIFNNGPTWK^-OH
<p>Peptide H-GIIFNNGPTWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 15 (LVSQYTPDSTPCHRG)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,660.8 g/molHIV - 1 MN gp160 Fragment 10
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :2,261.8 g/molH-TGSGDIENYNDATQVR^-OH
<p>Peptide H-TGSGDIENYNDATQVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GLP-1 (9-36) amide
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C140H214N36O43Masse moléculaire :3,089.44 g/molTNF-α (46-65) (human)
CAS :<p>TNF-α is a cytokine that regulates a wide variety of cellular processes, including cell proliferation, differentiation, and apoptosis. TNF-α functions as an important regulator of the immune system. This peptide inhibits the activity of TNF-α by binding to the receptor on cells and blocking its signaling. TNF-α (46-65) can be used in research applications such as protein interactions, activator, ligand, receptor, ion channels and antibody production.</p>Formule :C110H172N24O30Degré de pureté :Min. 95%Masse moléculaire :2,310.7 g/molH-VTQSNFAVGYK^-OH
<p>Peptide H-VTQSNFAVGYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-L^QSLFDSP^DFSK^-OH
<p>Peptide H-L^QSLFDSP^DFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPDATPTELAK^-OH
<p>Peptide H-LPDATPTELAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYTVDLGR^-OH
<p>Peptide H-VYTVDLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DI^TPTLTLYVGK^-OH
<p>Peptide H-DI^TPTLTLYVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Substance P (5-11)/Hepta-Substance P
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C41H60N10O9SMasse moléculaire :869.06 g/molN-Me-D-Glu-OH
CAS :<p>N-Me-D-Glu is an amino acid that is a substrate for the enzyme glutamate dehydrogenase. It is also a substrate for the enzyme N-acetylglutamate synthase and can be converted to glutamine. This amino acid has been extensively studied in relation to its conformational properties and its ability to form covalent adducts with amines. The type species of this amino acid is Saccharomyces cerevisiae, which contains an active glutamate dehydrogenase.</p>Formule :C6H11NO4Degré de pureté :Min. 95%Masse moléculaire :161.16 g/molH-DYVEINGEK^-OH
<p>Peptide H-DYVEINGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSYQVY^SK^-OH
Peptide H-TSYQVY^SK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-32/aa125 - 139
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,731.9 g/molGalacto-RGD2
<p>When 99mTc-labeled, this cyclic RGD dimer is a useful tool for tumor imaging. This novel galacto RGD dimer has enhanced hydrophilic properties that improve biodistribution and tumor-imaging in comparison to 3P-RGD2 tracer. This product is available as a trifluoroacetate salt.</p>Formule :C91H137N29O32Degré de pureté :Min. 95%Masse moléculaire :2,149.24 g/molH3(1-14)K4me3
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-TVLAVFGK^-OH
<p>Peptide H-TVLAVFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-HSSKLQL-NH2
<p>Peptide Ac-HSSKLQL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TTEPVSELLK^-OH
<p>Peptide H-TTEPVSELLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CKSGTGIAAMSVMRPEQ-NH2
<p>Peptide Ac-CKSGTGIAAMSVMRPEQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PKCPEPCPPPKCPQPCPP-NH2
Peptide H-PKCPEPCPPPKCPQPCPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-TRPPTLSPIPHIP-NH2
Peptide Biot-TRPPTLSPIPHIP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SHALQLNNR^-OH
<p>Peptide H-SHALQLNNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Huwentoxin- IV
<p>Huwentoxin IV is a peptide that is used as a research tool to investigate protein interactions. It binds to the receptor of a specific ligand and activates ion channels, which are pores in the cell membrane that allow ions to flow into and out of cells. Huwentoxin IV has been shown to inhibit protein interactions by preventing phosphorylation of proteins, which is necessary for protein-protein interactions. This process has also been shown to activate ion channels in the cell membrane. Huwentoxin IV is an inhibitor of protein-protein interactions and cell proliferation.</p>Formule :C174H278N52O51S6Degré de pureté :Min. 95%Masse moléculaire :4,106.8 g/molH-FTVLTESAAK^-OH
Peptide H-FTVLTESAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tyrosyl-prolyl-tryptophyl-threonine
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C29H35N5O7Masse moléculaire :565.6 g/molH-APEEILAEK^-OH
<p>Peptide H-APEEILAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>6Fam-SHLVEALYLVCGERG-NH2
<p>Peptide 6Fam-SHLVEALYLVCGERG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTL^MI^SR-OH
<p>Peptide H-DTL^MI^SR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-VFAQ-OH
<p>Peptide Ac-VFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVSEIQLMHNLGK^^-OH
<p>Peptide H-SVSEIQLMHNLGK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pr-EIR^-OH
<p>Peptide Pr-EIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AL^NSEALSV-OH
Peptide H-AL^NSEALSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TITSSYYR^-OH
<p>Peptide H-TITSSYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FELLPTPPLSPSR^-OH
<p>Peptide H-FELLPTPPLSPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGPFSDSYR^-OH
<p>Peptide H-GGPFSDSYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-AVAGCAGAR-OH
<p>Peptide Ac-AVAGCAGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-QEPEPPEPFEYIDD-NH2
<p>Peptide LCBiot-QEPEPPEPFEYIDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Mal-RTRPLWVRME-OH
<p>Peptide Mal-RTRPLWVRME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IVG^G^K-OH
<p>Peptide H-IVG^G^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SWTWEGNKWTWK-NH2
<p>Peptide H-SWTWEGNKWTWK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-YGGFLRRI-OH
<p>Peptide LCBiot-YGGFLRRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLWC-NH2
<p>Peptide H-HLWC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-REDEDEIEW-NH2
<p>Peptide H-REDEDEIEW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLVQQEGQLEQQER^-OH
Peptide H-HLVQQEGQLEQQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVVTQF^-OH
Peptide H-TVVTQF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IADYNYK^-OH
<p>Peptide H-IADYNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-K^TSAVLQ-OH
Peptide H-K^TSAVLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYSMEHFR^-OH
Peptide H-SYSMEHFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-L^VAASQAALGL-OH
<p>Peptide H-L^VAASQAALGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALQASALAAWGGK^-OH
<p>Peptide H-ALQASALAAWGGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>The ME™ Kit (plasma), patent US 8,956,878
The ME™ Kit is used for specific isolation of extracellular vesicles (exosomes, microvesicles) in as little as 45 minutes using a standard bench top centrifuge. This product is optimized for urine or media samples and contains the 1mg Vn96 peptide (enough for 20x samples), 500µl ME buffer, a negative control (100µg Vn96 scrambled peptide) and 50µl purified exosomes from HEK293 cells as positive control.Extracellular vesicle isolation, is becoming essential in diagnostics and therapeutics. These small membrane-enclosed particles play important roles in many biological processes, including communication, immune response, tissue regeneration, and tumor progression. They are also being studied for their use as biomarkers for various diseases and as potential therapeutics against cancer, neurodegenerative disorders, and inflammatory conditions. It is becoming known that blood profiling alongside exosome analysis provides scientists with suitable resources to monitor disease progression. To combat the challenges associated with exosome isolation Cymit Quimica have developed two ME™ Kits, available for purchase online based on optimization for how different sample types behave: urine or media samples (ME-020) and plasma samples (ME-020P). Our technique produces results comparable to ultracentrifugation, but at much greater efficiency as 1/30th the sample size is required, fulfilling the needs of the diagnostic and pharma industries. The underlaying mechanisms of how the kit works – an affinity for canonical HSPs – may allow for this to be applied fairly broadly, since HSPs are roundly conserved from bacteria to higher order mammals.For more information on the effectiveness and flexibility of this extracellular isolation technology read our publication (Gosh, 2014).Degré de pureté :Min. 95%H-DGLILTSR^-OH
<p>Peptide H-DGLILTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HMTEVVR^HC-OH
<p>Peptide H-HMTEVVR^HC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SATP^E^-OH
<p>Peptide H-SATP^E^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-K^TSAVLQSGFRKME-OH
<p>Peptide H-K^TSAVLQSGFRKME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-DTSHARPPGPGRALLEC-NH2 PAB-403-465B
Peptide Ac-DTSHARPPGPGRALLEC-NH2 PAB-403-465B is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-VALDPIDISIVLNKIKSDLEESKEWIRRSNKILDSI-NH2
Peptide Ac-VALDPIDISIVLNKIKSDLEESKEWIRRSNKILDSI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CONSENSUS B Tat - 17
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,619.8 g/molH-LGADMEDVCGR^-OH
<p>Peptide H-LGADMEDVCGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 23 (NVSVNVHNPTGRSIC)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,596.8 g/molH-YGLVTYATYPK^-OH
Peptide H-YGLVTYATYPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDLTIANLGTSEGR^-OH
<p>Peptide H-GDLTIANLGTSEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 19 (NQLQVQHTYFTGSEV)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,750.9 g/molH-GCSFLPDPYQK^-OH
<p>Peptide H-GCSFLPDPYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5Azido-GIGAVLKVLTTGLPALISWIKRKRQQ-OH
Peptide 5Azido-GIGAVLKVLTTGLPALISWIKRKRQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VNVDEVGGEALGR^^-OH
<p>Peptide H-VNVDEVGGEALGR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-REEEDK-NH2
<p>Peptide H-REEEDK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSP^DDSAGASALLR-OH
<p>Peptide H-FSP^DDSAGASALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>6Azido-TFYGGRPKRNNFLRGIR-NH2
<p>Peptide 6Azido-TFYGGRPKRNNFLRGIR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Masse moléculaire :2,190.56 g/molHXB2 gag NO-16
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,599.8 g/mol5Tamra-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5Tamra-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ITGLDPAGPNFEYAEAPSR^-OH
<p>Peptide H-ITGLDPAGPNFEYAEAPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EGDCNFVAPQGISSIIK^-OH
Peptide H-EGDCNFVAPQGISSIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Influenza A NP (366 - 374) Strain A/NT/60/68
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C36H59N11O17S2Masse moléculaire :982.06 g/molH-VTEPISAESGEQVER^-OH
Peptide H-VTEPISAESGEQVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGGFL^RRQFKVVT-OH
<p>Peptide H-YGGFL^RRQFKVVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Amyloid Precursor Protein (APP) (44 - 62)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :2,105.3 g/molH-DPLPDPLLDK^-OH
Peptide H-DPLPDPLLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HNLGHGHK^-OH
<p>Peptide H-HNLGHGHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-SPQLATLADEVSASLAKQGL-OH
<p>Peptide Ac-SPQLATLADEVSASLAKQGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
![[Des-Arg9]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50709.webp&w=3840&q=75)
