Peptides

<p>Peptide H-VINDFVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Biot-ERGVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IIPGGIYDADLNDEWVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-GSSDVDQLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-STVHEILCKLSLEG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Glutaryl-Phe-Ala-Ala-Phe-AMC TFA salt is a fine chemical, useful building block, and research chemical. It is a high quality, versatile scaffold that can be used as a reaction component or intermediate in the synthesis of complex compounds.

Peptide Fluor-ENPVVHFFKNIVTPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-LGADMEDVCGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-AVEEVSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-GDLTIANLGTSEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SANILLDEAF^TAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-TKQTAR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-KPVSLSYRCPCR^FFE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SFEDIHHYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-REEEDK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FSP^DDSAGASALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 6Azido-TFYGGRPKRNNFLRGIR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-LEAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LLQQFPLDLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LLRSSLILLQGSWF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide Abz-TPFSGQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DAEFR^HDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-EGDCNFVAPQGISSIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Please enquire for more information about rec IL-3 (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-K^AFSPEVIPMF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide Ac-CSDPVATSSTLGLQENMRTS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Ac-Leu-Gly-Pro-Lys-Acc-NH2 is a peptide that has the amino acid sequence of Leu, Gly, Pro and Lys. It is an enzyme substrate that has a high specificity for thrombin. Ac-Leu-Gly-Pro-Lys-Acc-NH2 has been shown to have a kinetic constant of 0.063/min/mg and a kinetic rate of 0.21/min when incubated with thrombin at 37°C in phosphate buffer (pH 7.4).

<p>Peptide H-VLNDILSR^L-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-IILEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-DQIPELENNEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Please enquire for more information about rec IL-4 (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide H-LGSSEVEQVQLVVDGVK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-HLEEQIAK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Ovalbumin (OVA) is the primary protein in egg-white, and is involved in initiating food allergies and asthma. It is a highly immunogenic protein and can be used for peptide conjugation in the development of antibodies.OVA (323-339) is a class I (Kb)-restricted peptide epitope of OVA. The ovalbumin fragment is presented by the class I MHC molecule, H-2Kb.</p>

<p>Peptide H-ILDFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-HHHHHHC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>This is a vivitide catalogue product. Please send your vivitide product enquiry to sales@vivitide.com for an up-to-date price and availability.</p>

Peptide Ac-RGDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-SFIEDLLFNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VL^DFAPPGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-IFYNQQNHYDGSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-FVFG^T^TPEDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-SLAPYAQDTQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-HLGGSQQLLHNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide pE-HWSYGLRPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-GRKKRRQRRRPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-VAPEEHPVLLTEAPLNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Aoa-KSKTKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Ac-VGVAPG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide H-HMTEVVR^RC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-GDTGETGVTGVEGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Fluorogenic substrate targeting pancreatic and urinary Kallikrein

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-YLAEVAAGDDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-GTVGGYFL^AGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-QTALVELVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YDPSLKPLSVSYDQATSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FALPQYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-SQNYPIVQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-PQNLLLDPDTAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NQAEEELIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LDELLQSQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

Peptide H-LDLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-ISIDVNNNDIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-AFALWSAVTPLTFTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-V^V^GGLVALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

L-threo-Phenylserine is a naturally occurring amino acid that is synthesized in the human body. It can be found in the brain and muscles, where it is used for protein synthesis. L-threo-phenylserine has been shown to be an effective oxygen nucleophile and can catalyze the hydrolysis of hydrogen fluoride. This compound has also been shown to have biological activity in vitro as well as structural properties that are useful for conformational analysis and structural biology research. L-threo-phenylserine may also have potential medical applications, such as its use as a treatment for mental disorders and epilepsy.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H2NCO-HAEGTFTSDVSSYLEGQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SIITFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GPVSVGVDAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-FG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-VLQWAEKGYYTMSNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-RNQDQQGPFKMC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-STQSAIDQI^TGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-LSSPAVITDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IGSEAYNQQLSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Anti-Flt1 Peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-QQRFEWEFEQQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-DWSSWVYRDPQT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Please enquire for more information about Fmoc-Trp(Boc)-Rink-Amide MBHA Resin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide H-GVQIPLPEGINFVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-HAIYPRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-IQKEIDRLNEVAKNLNESLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-IGGHGAEYGAEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LHGGSPWPPCQYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide Ac-CQLINTNGSWHINCK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-IPAMVVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-NIQLINTNGSWHINST-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YGNGVWIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide H-LNNISIIGPLDMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-EIGELYLP^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GQSIQPFISR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-PHSRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-QLSESQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide 5Hexynoic-CTTHWGFTLC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-SHFANL^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-DVLETFTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-TYLPAVDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-GLQTSQDAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YTIAALLSPYSYSTTAVVTNPK^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LSITIRPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TA^VNALWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-GITWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

MeOSuc-Ala-Ala-Pro-Met-AMC is a substrate for the aminopeptidase. It has been shown to have minimal effects on intestinal cells and analyzed peptidases, proteolytic peptidases, and aminopeptidases. This compound is not pathogenic and can be used as a modulator of oncospheres and parasites.

<p>Peptide H-SVSEINPTTQMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Fmoc-FAVP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-GYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-WYQSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

H-Glu-Glu-Leu-OH is a vitamin that is essential for the production of hydroxyproline, which aids in the formation of collagen. It is also used to treat osteoarthritis and rheumatoid arthritis. H-Glu-Glu-Leu-OH is synthesized from glutamate, glutamic acid, and leucine in the liver and kidney. This reaction proceeds by two steps: first, glutamate carboxylase converts glutamate to α-ketoglutarate; then, aspartate aminotransferase converts α-ketoglutarate to aspartate semialdehyde. Aspartate semialdehyde is converted to H-Glu-Glu-Leu by an enzyme called glutamyl aminopeptidase. The reaction mechanism of this enzyme has been studied experimentally and theoretically using sodium bicarbonate (NaHCO) as a buffer. The sequential nature

<p>Peptide H-V^YIHPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

H-Asp(Lys-OH)-OH is a metabolite that is an intermediate in the fatty acid oxidation pathway. It may be involved in the progression of colorectal carcinoma by inhibition of fatty acid synthesis, leading to the accumulation of fatty acids and subsequent death. This metabolite can also be used to identify potential biomarkers for colorectal cancer. H-Asp(Lys-OH)-OH can be detected using liquid chromatography coupled with mass spectrometry (LC/MS).

Peptide H-LGYPITDDLDIYTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-GFYFNKPTGYGSSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-LEETVQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-LYL^VCGERGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>PTH is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications and is available as a 20µg vial.</p>

Peptide H-ATEII^EPSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

H-Ala-Asp-OH is a tetrapeptide that belongs to the group of p2, acidic, magnetic and isomeric haemoglobins. This molecule has been shown to hydrolyze enzymes in red blood cells. H-Ala-Asp-OH also binds to red blood cells and may be involved in the regulation of oxygen transport. The magnetic properties of this molecule have been studied by NMR spectroscopy and X-ray crystallography.

Peptide H-QIVQNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Please enquire for more information about rec FGF acidic (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Peptide H-AVEIGSFLLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-EEQYNSTYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-VDSALYLGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FGVAPDHPEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YFDSFGDLSSASAIMGNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide 5TAMRA-LKRYKRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

H-Ser-His-OH acetate salt is an amide that has been shown to have a neutral pH and to be soluble in organic solvents such as chloroform. It has a biological function of being a serine protease inhibitor. H-Ser-His-OH acetate salt binds to the amino acid histidine and inhibits the activity of serine proteases. This product has been used in fluorescence techniques, immunofluorescence analyses, and molecular biology.

HRK-Y is a synthetic BH3 peptide that selectively antagonizes BCL-XL, a pro-survival protein of the Bcl-2 family. This interaction disrupts the balance of Bcl-2 family proteins, leading to cytochrome c release and subsequent apoptosis in susceptible cancer cells. HRK-Y is utilized in BH3 profiling assays to assess the sensitivity of cancer cells to BH3-mimetic drugs and to identify potential synergistic effects with NK cell-based therapies.

Peptide H-YTDV^SNMSHLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-ATVVYQ^GER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-IDEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Annexin A1 is a phospholipid-binding protein that is involved in the regulation of inflammation. It is often found in atherosclerotic lesions and has been shown to be an anti-inflammatory cytokine. Annexin A1 (dephosphorylated) does not inhibit the activity of enzymes such as cyclooxygenase and lipoxygenase, and so it may have therapeutic potential for treatment of autoimmune diseases such as Crohn's disease or bowel disease. Annexin A1 also has anti-inflammatory properties, which may be due to its ability to inhibit the production of proinflammatory cytokines such as IL-6 and TNF-α by inhibiting the activation of NFκB.

H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide Aoa-KRRGSTCVLA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DLSLEEIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-SIAFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-EGYLQIGANTQAAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide LCBiot-QDGNEEMGGITQTPYKVSISGTTVILT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TYFAVLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-YGGFLRRIRPKLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VVDVEEQQLEESGPHDLTETSYLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Pal-KVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-EALDESIPPVSFWR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DALSSVQESQVAQQ^AR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-SEVAHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Please enquire for more information about rec Oncostatin M (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Peptide H-VITKPFTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NVDLSTFYQNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YWGVASFLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Z-Gly-Met-OH is a buffer that can be used to create an acidic solution. It is often used in liquid chromatography and peptide synthesis. Z-Gly-Met-OH has been shown to have potential use as an enzyme inhibitor, specifically for proteases and peptidases. The hydrolyzed form of Z-Gly-Met-OH has been shown to bind zinc ions and could be used in the treatment of metal ion poisoning.

<p>Peptide H-EITFHGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>