Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30311 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Peptide T
Peptide Peptide T is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formule :C35H55N9O16Masse moléculaire :857.8 g/molAc-KKLETFSSTN-OH
<p>Peptide Ac-KKLETFSSTN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-DLIEEAASRIVDAVIEQVKAAGAY-NH2
Peptide Ac-DLIEEAASRIVDAVIEQVKAAGAY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-54/aa213 - 227
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,550.7 g/molH-IL^DTAGL^EEY-OH
<p>Peptide H-IL^DTAGL^EEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TESTLNALLQR^-OH
<p>Peptide H-TESTLNALLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]-4-methylpentanoyl]am ino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]amino]-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C42H74N10O12SMasse moléculaire :943.18 g/molH-LDVHYAPTIR^-OH
<p>Peptide H-LDVHYAPTIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALQVVR^-OH
<p>Peptide H-ALQVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Boc-RRR-OH
Peptide Boc-RRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Dynorphin A (1-17)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C99H155N31O23Masse moléculaire :2,147.5 g/molLCBiot-KRKLIVDSVKELDSKTIRAQLSDYS-OH
<p>Peptide LCBiot-KRKLIVDSVKELDSKTIRAQLSDYS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PAFSAIR^-OH
<p>Peptide H-PAFSAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPSGPGPPSPTPPAPR^-OH
Peptide H-RPSGPGPPSPTPPAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SWFR-NH2
<p>Peptide Ac-SWFR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Lys27(Azido), Exendin-4
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C189H293N52O61SMasse moléculaire :4,311.96 g/molH-SALVLQYLR^-OH
<p>Peptide H-SALVLQYLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIFAGKQLEDGR^-OH
Peptide H-LIFAGKQLEDGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDMGDVQHFADDVIAQR^-OH
<p>Peptide H-GDMGDVQHFADDVIAQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FVSGVLSDQMSAR^-OH
<p>Peptide H-FVSGVLSDQMSAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPKMVQGSGCFGR^KMDRISSSSGLGCK^VLRRH-OH
<p>Peptide H-SPKMVQGSGCFGR^KMDRISSSSGLGCK^VLRRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFADINLYR^-OH
<p>Peptide H-SFADINLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DINAYNCEEPTEK^-OH
<p>Peptide H-DINAYNCEEPTEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTEHDTLLY-NH2
<p>Peptide H-VTEHDTLLY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LFEELVR^-OH
Peptide H-LFEELVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FTITAGSK^-OH
<p>Peptide H-FTITAGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGVNGFGR^-OH
Peptide H-VGVNGFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYTITGLQPGTDYK^-OH
<p>Peptide H-SYTITGLQPGTDYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 28
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,715.1 g/molAc-CARSIGDDTFRLDRWETE-NH2
<p>Peptide Ac-CARSIGDDTFRLDRWETE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALDLLDK^-OH
Peptide H-ALDLLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-AGGKAGKDSGKAKAKAVSR-OH
<p>Peptide Ac-AGGKAGKDSGKAKAKAVSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLKEIFKAGLGSLVKGIAAHVAS-NH2
<p>Peptide H-GLKEIFKAGLGSLVKGIAAHVAS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Trp-Ile-Arg
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C23H35N7O4Masse moléculaire :473.57 g/molH-LPDA^TPTELA^K^-OH
Peptide H-LPDA^TPTELA^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 132 (AELEGVWQPAAQPKR)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,679.9 g/molH-SIINFEK^L-OH
<p>Peptide H-SIINFEK^L-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 113 (GVMTRGRLKAESTVA)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,575.9 g/molH2N-Ser-Cys-Arg-Trp-Arg-Phe-Pro-Ala-Arg-Pro-Gly-Th
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C63H96N22O15S1Masse moléculaire :1,433.64 g/molMyr-SIYRRGARRWRKL-OH
Peptide Myr-SIYRRGARRWRKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TEQQWNFAGIR^-OH
<p>Peptide H-TEQQWNFAGIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NINNN-NHMe
Peptide H-NINNN-NHMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RP^QQPYPQPQPQY-OH
<p>Peptide H-RP^QQPYPQPQPQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPDENFK^-OH
<p>Peptide H-FPDENFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
<p>Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SDAPIGK^-OH
<p>Peptide H-SDAPIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-RRPRSPAKLSFQFPS-NH2
<p>Peptide Fluor-RRPRSPAKLSFQFPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLQAQGYGVR^-OH
Peptide H-GLQAQGYGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C13H24N4O6S1Masse moléculaire :364.42 g/molH-VQAAVGTSAAPV^PSDNH-OH
<p>Peptide H-VQAAVGTSAAPV^PSDNH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLIYGAFSR^-OH
<p>Peptide H-LLIYGAFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>2Azido-GRKKRRQRRRPPQ-OH
<p>Peptide 2Azido-GRKKRRQRRRPPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-GRGDSP-NH2
<p>Peptide Ac-GRGDSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Influenza Virus A/Aichi/2/68 Haemagglutinin HA1 (195-209), X-31
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,666.9 g/molSIVmac239 - 34
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,658.8 g/molAc-RYDLGGAGMVC-NH2
<p>Peptide Ac-RYDLGGAGMVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AATVGSLAGQPLQ^ER-OH
<p>Peptide H-AATVGSLAGQPLQ^ER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MIQPSASGSLVGR^-OH
<p>Peptide H-MIQPSASGSLVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FESNFNTQATNR^-OH
<p>Peptide H-FESNFNTQATNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QIYGAK^-OH
<p>Peptide H-QIYGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSALTPSPSWLKYKAL-NH2
<p>Peptide H-LSALTPSPSWLKYKAL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-ETFG-OH
Peptide Ac-ETFG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
<p>Peptide LCBiot-GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FIAGL^IAIV-OH
<p>Peptide H-FIAGL^IAIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MADDQGRGRRRPLNEDC-NH2
<p>Peptide H-MADDQGRGRRRPLNEDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-R^F^-OH
<p>Peptide H-R^F^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-IPESSELTLQELLGEERR-NH2
<p>Peptide LCBiot-IPESSELTLQELLGEERR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLPFQQFGR^-OH
Peptide H-FLPFQQFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSSFNPAALSR^-OH
Peptide H-NSSFNPAALSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASLFSFK^-OH
<p>Peptide H-ASLFSFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSGLVSNAPGVQIR^-OH
<p>Peptide H-SSGLVSNAPGVQIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-EQKLISEEDL-OH
<p>Peptide Ac-EQKLISEEDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Hemoglobin β chain [133-146]
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C66H104N20O17Masse moléculaire :1,449.6 g/molAc-AKFVAAWTLKAAA-NH2
<p>Peptide Ac-AKFVAAWTLKAAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QITIPSQEQEHSQK^-OH
Peptide H-QITIPSQEQEHSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-RRKDLHDDEEDEAMSITA-OH
<p>Peptide Biot-RRKDLHDDEEDEAMSITA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WRQAAFVDSY-NH2
<p>Peptide H-WRQAAFVDSY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Melanotan I
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C78H111N21O19Masse moléculaire :1,646.9 g/molZ-LLY-NH2
<p>Peptide Z-LLY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGGPEAGLGEYLFER^-OH
<p>Peptide H-LGGPEAGLGEYLFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Protease-Activated Receptor-2, PAR-2 Agonist, amide
<p>Peptide Protease-Activated Receptor-2, PAR-2 Agonist, amide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C28H54N8O7Masse moléculaire :614.79 g/molH-LLIYGASSR^-OH
<p>Peptide H-LLIYGASSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FEDENFILK^-OH
<p>Peptide H-FEDENFILK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FESSAAKLKRKYWWKNLK^-OH
<p>Peptide H-FESSAAKLKRKYWWKNLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-FAKKFAKKFKKFAKKFAKFAFAF-NH2
<p>Peptide Ac-FAKKFAKKFKKFAKKFAKFAFAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-PLL-OH
<p>Peptide Ac-PLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FFEILSPVYR^-OH
<p>Peptide H-FFEILSPVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-1-oxo-3-phenylpropan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino ]-4-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-4-[[(2S)-2-[[(2S)-2,6-diaminohexanoyl]amino
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C47H70N14O10Masse moléculaire :991.17 g/molH-EAMEHPYFYTVVK^-OH
<p>Peptide H-EAMEHPYFYTVVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESTLHLVLRLR^GG-OH
<p>Peptide H-ESTLHLVLRLR^GG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIYETDYYR^-OH
Peptide H-DIYETDYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Z-Gln-Gly-OH
CAS :<p>Z-Gln-Gly-OH is a synthetic dipeptide, which is a modified amino acid sequence commonly used in biochemical applications. It consists of a carbobenzoxy-protected glutamine and a glycine residue. This compound originates from custom organic synthesis, derived through specific chemical protocols to introduce protective groups that block reactive sites on the amino acids. This controlled modification alters the peptide's stability and solubility.The mode of action involves the protection of active sites during complex syntheses, enabling the sequential construction of peptide chains without unintended reactions. This protection is critical in solid-phase peptide synthesis methodologies where precision and specificity of reactions are paramount. The Z-group (benzyloxycarbonyl) ensures the stability of glutamine under various chemical conditions, preventing side reactions that may compromise the integrity of peptide constructs.In research, Z-Gln-Gly-OH finds applications in the design of peptide-based inhibitors, structural studies, and the synthesis of longer chain peptides that mimic biologically relevant structures. The protection strategy allows scientists to develop and manipulate peptides with high fidelity, facilitating advancements in understanding protein functions and interactions in physiological contexts.</p>Formule :C15H19N3O6Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :337.33 g/molH-NGFYPATR^-OH
<p>Peptide H-NGFYPATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-ARARARAR-OH
<p>Peptide Biot-ARARARAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>G-R-G-D-S-P
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C22H37N9O10Masse moléculaire :587.59 g/molH-SDAPI^GK-OH
<p>Peptide H-SDAPI^GK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLASVSTVLTSK^-OH
Peptide H-FLASVSTVLTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EILVGDVGQTVDDPYATFVK^-OH
<p>Peptide H-EILVGDVGQTVDDPYATFVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RGDNNL^TRIVGGQE-OH
<p>Peptide H-RGDNNL^TRIVGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTPTAENPEYLGL^DVPV-OH
<p>Peptide H-GTPTAENPEYLGL^DVPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLFSVHWPPLKA-NTBiot
<p>Peptide H-YLFSVHWPPLKA-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLSLLTTLSNR^-OH
<p>Peptide H-HLSLLTTLSNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AIPELTK^-OH
Peptide H-AIPELTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-GRADSP-NH2
Peptide Biot-GRADSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CRRVIGAKKDQY-NH2
Peptide Ac-CRRVIGAKKDQY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSTSEIASHLPTK^^-OH
<p>Peptide H-LSTSEIASHLPTK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-46
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,624.8 g/molH-LILNEVSLLGSAPGGK^-OH
<p>Peptide H-LILNEVSLLGSAPGGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EKAHDGGR^YYRA-OH
<p>Peptide H-EKAHDGGR^YYRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5FAM-HQSYVDPWMLDH-OH
<p>Peptide 5FAM-HQSYVDPWMLDH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVFDFSQR^-OH
<p>Peptide H-EVFDFSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-L^LQQFPLDLEK^-OH
<p>Peptide H-L^LQQFPLDLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-26
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,788 g/molH-CKLVFF-NH2
Peptide H-CKLVFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Histone H3 peptide (non-modified A.A. 1-44), biotin
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-DVSQSSISFQIEK^-OH
<p>Peptide H-DVSQSSISFQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AYPDANLLNDR^-OH
<p>Peptide H-AYPDANLLNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IFVEESIYDEFVR^-OH
<p>Peptide H-IFVEESIYDEFVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pancreastatin, Porcine
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C214H330N68O76SMasse moléculaire :5,103.4 g/mol5Fam-DRVYIHPF-OH
<p>Peptide 5Fam-DRVYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GYLPEPVTVTWNSGTLTNGVR^-OH
Peptide H-GYLPEPVTVTWNSGTLTNGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HQFLLTGDTQGR^-OH
<p>Peptide H-HQFLLTGDTQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TEGLQEALLK^^-OH
<p>Peptide H-TEGLQEALLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Phosphatidylcholine-sterol acyltransferase [086-099]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMet-Enkephalin
<p>Peptide Met-Enkephalin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C27H35N5O7SMasse moléculaire :573.67 g/molH-VVSVLTVLHQDWLNGK^-OH
<p>Peptide H-VVSVLTVLHQDWLNGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TEAFIPFSLGK^-OH
Peptide H-TEAFIPFSLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSVVLGKKQRFHSWG-NH2
<p>Peptide H-NSVVLGKKQRFHSWG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALAAELNQLR^-OH
Peptide H-ALAAELNQLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MAGE-3 (191-205)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolArg-Glu-Gly-Val-Glu-Leu-Cys-Pro-Gly-Asn-Lys-Tyr-Gl
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C132H212N44O41S2Masse moléculaire :3,135.5 g/molH-ETPAATEAPSSTPK^-OH
Peptide H-ETPAATEAPSSTPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGQEIEVRPGIVSK^-OH
<p>Peptide H-VGQEIEVRPGIVSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>S961 TFA
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C211H297N55O71S2Masse moléculaire :4,804.13 g/molH-FSIEGNR^-OH
<p>Peptide H-FSIEGNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PEPAKSAPAPKKGSKKAVTKA-NH2
Peptide H-PEPAKSAPAPKKGSKKAVTKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KPWWPRR-NH2
<p>Peptide H-KPWWPRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ARKSTGGKAPRKQLC-NH2
<p>Peptide H-ARKSTGGKAPRKQLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Gly-Gly-Gly-Gly-Arg-Gly-Asp-Tyr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C29H43N11O12Masse moléculaire :737.72 g/molH-GDVFVIR^-OH
Peptide H-GDVFVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-SGTLGHPGSLDETTYER-OH
<p>Peptide LCBiot-SGTLGHPGSLDETTYER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Melanocyte Protein PMEL 17 (256-264)
CAS :<p>Peptide H-YLEPGPVTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C44H67N9O14Masse moléculaire :946.05 g/molH-VLVLDTDYKK^-OH
<p>Peptide H-VLVLDTDYKK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RTVAAPSVFIFPPSDEQLK^-OH
<p>Peptide H-RTVAAPSVFIFPPSDEQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TELLPGDRDNLAIQTR^-OH
Peptide H-TELLPGDRDNLAIQTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FL^GYLILGV-OH
<p>Peptide H-FL^GYLILGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASHLGLAR^-OH
<p>Peptide H-ASHLGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VFTPLEVDVAK^-OH
<p>Peptide H-VFTPLEVDVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Murine CMV pp 89 (168-176)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C53H74N12O13SMasse moléculaire :1,119.32 g/molH-SGAQASSTPLSPTR^-OH
<p>Peptide H-SGAQASSTPLSPTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV-1 env Protein gp120 (278-292) (strains BH10, BH8, HXB2, HXB3, PV22)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C73H126N26O18Masse moléculaire :1,656 g/molH-VASFHRQ-NH2
<p>Peptide H-VASFHRQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALEQDLPVNIK^-OH
<p>Peptide H-ALEQDLPVNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YARAAARQARAKALARQLGVAA-NH2
<p>Peptide H-YARAAARQARAKALARQLGVAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYKV-NH2
Peptide H-SYKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-LPETG-NH2
Peptide LCBiot-LPETG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YEINVLR^-OH
<p>Peptide H-YEINVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 113
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,606.9 g/molAc-LKISQAPQVSISRSKSYRENGAPFC-NH2
<p>Peptide Ac-LKISQAPQVSISRSKSYRENGAPFC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WYEIEK^-OH
<p>Peptide H-WYEIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTTFAEGVVAFLILPQAK^-OH
<p>Peptide H-GTTFAEGVVAFLILPQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LAVYQAGAR^-OH
<p>Peptide H-LAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 205
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,515.7 g/molH-GSFPWQA^K^-OH
<p>Peptide H-GSFPWQA^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVLHPNYSQVDIGL^IK-OH
<p>Peptide H-VVLHPNYSQVDIGL^IK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(D-Ala1)-Peptide T amide
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C35H56N10O15Masse moléculaire :856.89 g/molAc-IKPDVAVSC-NH2
<p>Peptide Ac-IKPDVAVSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-19/aa73 - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,775 g/molHXB2 gag NO-4
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,852.2 g/molH-KVLEHVVRV^-OH
<p>Peptide H-KVLEHVVRV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Abz-GVV-OH
<p>Peptide Abz-GVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAVPDAV^GK-OH
<p>Peptide H-AAVPDAV^GK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Bz-EYY-NH2
Peptide Bz-EYY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ERSPVIQTL^-OH
<p>Peptide H-ERSPVIQTL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-LVLRLRGG-OH
<p>Peptide LCBiot-LVLRLRGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YDIALVQEVR^-OH
<p>Peptide H-YDIALVQEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(Des-Glu²²)-Amyloid β-Protein (1-42)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C198H304N54O57SMasse moléculaire :4,384.99 g/molH-2Kb Mouse L protein LEYDFNKL
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-DGFFGNPR^-OH
<p>Peptide H-DGFFGNPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-FYWHCLDE-OH
<p>Peptide LCBiot-FYWHCLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGYSSPGSPGTPGSR^-OH
<p>Peptide H-SGYSSPGSPGTPGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SEEFLIAGK^-OH
Peptide H-SEEFLIAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLTWQELYQLKYKGI-NH2
<p>Peptide H-KLTWQELYQLKYKGI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATADDELSFK^-OH
Peptide H-ATADDELSFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-113/aa449 - 463
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,684.8 g/molH-KVLEYVIKV^-OH
Peptide H-KVLEYVIKV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SRTPSLPTPPTREPK^-OH
<p>Peptide H-SRTPSLPTPPTREPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVL^TIDK-OH
<p>Peptide H-AVL^TIDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-EEEPQEEIPYLELLP-NH2
<p>Peptide Ac-EEEPQEEIPYLELLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>γ ABU-GSDALDDFDLDML-OH
Peptide gamma ABU-GSDALDDFDLDML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSGDSSQVTQVSPQR^-OH
<p>Peptide H-GSGDSSQVTQVSPQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APPDNLPSPGGSR^-OH
<p>Peptide H-APPDNLPSPGGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-KYEQYIKW-NH2
Peptide LCBiot-KYEQYIKW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SQIFSTASDNQPTVTIK^-OH
<p>Peptide H-SQIFSTASDNQPTVTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGSGDIENYNDATQVR^-OH
<p>Peptide H-TGSGDIENYNDATQVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIINFEKL-cysteamide
Peptide H-SIINFEKL-cysteamide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Leu-Ile-Thr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C16H31N3O5Masse moléculaire :345.43 g/molH-EDVPSER^-OH
<p>Peptide H-EDVPSER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FVNEEAL^R-OH
<p>Peptide H-FVNEEAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQII^NK^-OH
Peptide H-VQII^NK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![Hemoglobin β chain [133-146]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50835.webp&w=3840&q=75)
![(4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-1-oxo-3-phenylpropan-2-yl]amino]-5-(diaminomethyl…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50018.webp&w=3840&q=75)
![Phosphatidylcholine-sterol acyltransferase [086-099]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50833.webp&w=3840&q=75)
