Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29890 produits trouvés pour "Peptides"
H-SFEDIHHYR^-OH
Peptide H-SFEDIHHYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EIGELYLP^K-OH
Peptide H-EIGELYLP^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-PHSRN-NH2
Peptide Ac-PHSRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Hexynoic-CTTHWGFTLC-OH
Peptide 5Hexynoic-CTTHWGFTLC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SHFANL^K-OH
Peptide H-SHFANL^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SNRP70
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-DVLETFTVK^-OH
Peptide H-DVLETFTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAEFR^HDSGYEVHHQ-OH
Peptide H-DAEFR^HDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Glu-Glu-Leu-OH
CAS :H-Glu-Glu-Leu-OH is a vitamin that is essential for the production of hydroxyproline, which aids in the formation of collagen. It is also used to treat osteoarthritis and rheumatoid arthritis. H-Glu-Glu-Leu-OH is synthesized from glutamate, glutamic acid, and leucine in the liver and kidney. This reaction proceeds by two steps: first, glutamate carboxylase converts glutamate to α-ketoglutarate; then, aspartate aminotransferase converts α-ketoglutarate to aspartate semialdehyde. Aspartate semialdehyde is converted to H-Glu-Glu-Leu by an enzyme called glutamyl aminopeptidase. The reaction mechanism of this enzyme has been studied experimentally and theoretically using sodium bicarbonate (NaHCO) as a buffer. The sequential natureFormule :C16H27N3O8Degré de pureté :Min. 95%Couleur et forme :White Off-White PowderMasse moléculaire :389.40 g/molAmino-dPEG®4-t-Butyl Ester
CAS :Amino-dPEG®4-t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formule :C15H31NO6Degré de pureté :Min. 95%Masse moléculaire :321.41 g/molH-K^AFSPEVIPMF-OH
Peptide H-K^AFSPEVIPMF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Exendin-4
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C184H282N50O60SMasse moléculaire :4,186.7 g/molAc-CSDPVATSSTLGLQENMRTS-OH
Peptide Ac-CSDPVATSSTLGLQENMRTS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Asp(Lys-OH)-OH
CAS :H-Asp(Lys-OH)-OH is a metabolite that is an intermediate in the fatty acid oxidation pathway. It may be involved in the progression of colorectal carcinoma by inhibition of fatty acid synthesis, leading to the accumulation of fatty acids and subsequent death. This metabolite can also be used to identify potential biomarkers for colorectal cancer. H-Asp(Lys-OH)-OH can be detected using liquid chromatography coupled with mass spectrometry (LC/MS).Formule :C10H19N3O5Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :261.28 g/molAc-PGP-OH
Peptide Ac-PGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TA^VNALWGK^-OH
Peptide H-TA^VNALWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RR^-OH
Peptide H-RR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.N-Formylmethionyl-leucyl-tyrosine
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C21H31N3O6SMasse moléculaire :453.6 g/molH-GITWK^-OH
Peptide H-GITWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
6-Alkynyl-L-fucose tetraacetate
CAS :1,2,3,4-Tetra-O-acetyl-5-alkynyl-L-fucose is a per-O-acetylated version of 5-alkynyl-L-fucose, an inhibitor of the cellular fucosylation pathway. 1,2,3,4-Tetra-O-acetyl-5-alkynyl-L-fucose can pass through the eukaryotic cell membrane somewhat better than 5-alkynyl-L-fucose can itself, is deacetylated by cellular esterases and interferes with the biosynthesis of the fucosyl-donor and fucosyltransferase substrate GDP-Fuc, thus reducing fucosylation levels during glycoprotein biosynthesis.
Formule :C15H18O9Degré de pureté :Min. 95%Masse moléculaire :342.3 g/molH-FPLTNAIK^-OH
Peptide H-FPLTNAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STDTAYMELSSLR^-OH
Peptide H-STDTAYMELSSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVSEINPTTQMK^-OH
Peptide H-SVSEINPTTQMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Azido-Lys-OH
CAS :Fmoc-Azido-Lys-OH is a Building Block that contains the amino acid lysine and a divalent metal ion, such as zinc. This Building Block can be used in solid phase synthesis of peptides and proteins. Fmoc-Azido-Lys-OH has been shown to have neuroprotective effects against neurodegenerative diseases, such as Alzheimer's disease and Parkinson's disease, by inhibiting the aggregation of protein.Formule :C21H22N4O4Degré de pureté :Min. 98.0 Area-%Masse moléculaire :394.43 g/molH-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVL^VQREKDL^PNYNWNSFGL^RF-NH2
H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Formule :C258H401N79O78Masse moléculaire :5,857.5 g/molAc-GYG-OH
Peptide Ac-GYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TANDLNLLILR^-OH
Peptide H-TANDLNLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Ala-Asp-OH
CAS :H-Ala-Asp-OH is a tetrapeptide that belongs to the group of p2, acidic, magnetic and isomeric haemoglobins. This molecule has been shown to hydrolyze enzymes in red blood cells. H-Ala-Asp-OH also binds to red blood cells and may be involved in the regulation of oxygen transport. The magnetic properties of this molecule have been studied by NMR spectroscopy and X-ray crystallography.Formule :C7H12N2O5Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :204.18 g/molH-V^YIHPFHL-OH
Peptide H-V^YIHPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
rec FGF acidic (human)
CAS :Please enquire for more information about rec FGF acidic (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%Biotinoylsarcosine
CAS :Biotinoylsarcosine is a synthetic compound that is used in biotechnology as a building block for the production of biotin-conjugated proteins and peptides. Biotinoylsarcosine has been shown to bind to human serum albumin with high affinity, which may be due to its carboxylate functionalities. This chemical can also be conjugated with other molecules through multistep reactions, simplifying the process of creating biotin-conjugated compounds. Biotinoylsarcosine is deactivated by biotinidase enzymes and used as a pretargeting agent in positron emission tomography imaging studies. Streptavidin, an avidin protein, can bind this compound with high affinity and has been used in biochemical studies as a tool for peptide synthesis.Formule :C13H21N3O4SDegré de pureté :Min. 95%Masse moléculaire :315.39 g/molH-HEAWITLEK^-OH
Peptide H-HEAWITLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GFYFNKPTGYGSSSR^-OH
Peptide H-GFYFNKPTGYGSSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Ser-His-OH acetate
CAS :H-Ser-His-OH acetate salt is an amide that has been shown to have a neutral pH and to be soluble in organic solvents such as chloroform. It has a biological function of being a serine protease inhibitor. H-Ser-His-OH acetate salt binds to the amino acid histidine and inhibits the activity of serine proteases. This product has been used in fluorescence techniques, immunofluorescence analyses, and molecular biology.Formule :C9H14N4O4·xC2H4O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :242.24 g/molH-LYL^VCGERGF-OH
Peptide H-LYL^VCGERGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
m-dPEG®8-Azide (Azido-m-dPEG®8)
CAS :m-dPEG®8-Azide (Azido-m-dPEG®8) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®8-Azide (Azido-m-dPEG®8) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Degré de pureté :Min. 95%Masse moléculaire :409.48 g/molH-ATEII^EPSK-OH
Peptide H-ATEII^EPSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Leupeptin hemisulfate anhydrous (vial)
CAS :Leupeptin is an ion channel blocker that belongs to the group of protease inhibitors. It blocks the passage of ions across cell membranes by binding to the active site of a variety of enzymes in the membrane. Leupeptin is used as a research tool for studying protein interactions, and can be used for antibody production. Leupeptin is also useful in cell biology studies, because it inhibits the activation of many proteins involved in signal transduction and cell division.Formule :C20H38N6O4Degré de pureté :Min. 95%Masse moléculaire :426.55 g/molH-GTVGGYFL^AGR^-OH
Peptide H-GTVGGYFL^AGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QTALVELVK^-OH
Peptide H-QTALVELVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FALPQYLK^-OH
Peptide H-FALPQYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C49H74N10O11Masse moléculaire :979.18 g/molH-VDSALYLGSR^-OH
Peptide H-VDSALYLGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PQNLLLDPDTAVLK^-OH
Peptide H-PQNLLLDPDTAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FGVAPDHPEVK^-OH
Peptide H-FGVAPDHPEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDELLQSQIEK^-OH
Peptide H-LDELLQSQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Myr-GSNK^SK^PK-NH2
Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-K^CNTA^TCATQRLANFLVHSSNNFGAILSSTNVG^SNTY-NH2
H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-LDLER^-OH
Peptide H-LDLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISIDVNNNDIK^-OH
Peptide H-ISIDVNNNDIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ATVVYQ^GER-OH
Peptide H-ATVVYQ^GER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Annexin A1(1-25)(dephosphorylated)(human)ammonium salt
CAS :Annexin A1 is a phospholipid-binding protein that is involved in the regulation of inflammation. It is often found in atherosclerotic lesions and has been shown to be an anti-inflammatory cytokine. Annexin A1 (dephosphorylated) does not inhibit the activity of enzymes such as cyclooxygenase and lipoxygenase, and so it may have therapeutic potential for treatment of autoimmune diseases such as Crohn's disease or bowel disease. Annexin A1 also has anti-inflammatory properties, which may be due to its ability to inhibit the production of proinflammatory cytokines such as IL-6 and TNF-α by inhibiting the activation of NFκB.Formule :C141H210N32O44S·NH4Degré de pureté :Min. 97 Area-%Couleur et forme :White PowderMasse moléculaire :3,107.47 g/molZ-Gly-Met-OH
CAS :Z-Gly-Met-OH is a buffer that can be used to create an acidic solution. It is often used in liquid chromatography and peptide synthesis. Z-Gly-Met-OH has been shown to have potential use as an enzyme inhibitor, specifically for proteases and peptidases. The hydrolyzed form of Z-Gly-Met-OH has been shown to bind zinc ions and could be used in the treatment of metal ion poisoning.Formule :C15H20N2O5SDegré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :340.4 g/molChloromethylated Polystyrene Resin (200-400 mesh) 1% DVB
CAS :Chloromethylated Polystyrene Resin (200-400 mesh) 1% DVB is a reaction solution that is used in biological studies. It reacts with human serum to form a bicyclic heterocycle. The hydrogen fluoride in the reaction solution reacts with the trifluoroacetic acid to form an intermediate, which then reacts with the chloromethylated polystyrene resin to form the bicyclic heterocycle. The redox potentials of this reaction are measured and can be used as a probe for determining the chemical stability of this product. This product has been shown to have fluorescence properties and can be used as a probe for detecting DNA and RNA samples in vitro.Degré de pureté :Min. 95%H-Glu(Tyr-OH)-OH
CAS :H-Glu(Tyr-OH)-OH is an amino acid analogue that has been shown to have natriuretic effects. It also has anti-inflammatory and analgesic properties, which are likely due to its ability to inhibit the bacterial enzyme arginase. H-Glu(Tyr-OH)-OH is a part of a class of compounds called oximes, which are used in the treatment of poisoning by organophosphates, pyrethroid insecticides, and carbamates. The compound is synthesized by treating L-glutamic acid with hydrogen peroxide and tyrosine in acidic conditions. H-Glu(Tyr-OH)-OH has also been found to have a protective effect on alcohol induced damage in rats. This may be due to its ability to increase the synthesis of dopamine, which is involved in the regulation of blood pressure and water balance.Formule :C14H18N2O6Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :310.3 g/molAc-Ile-Glu-Pro-Asp-AMC
CAS :AMC conjugated molecule targeting caspase-8 and granzyme B
Formule :C32H41N5O11Degré de pureté :Min. 97 Area-%Couleur et forme :PowderMasse moléculaire :671.7 g/molH2NCO-HAEGTFTSDVSSYLEGQ-NH2
Peptide H2NCO-HAEGTFTSDVSSYLEGQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-QDGNEEMGGITQTPYKVSISGTTVILT-NH2
Peptide LCBiot-QDGNEEMGGITQTPYKVSISGTTVILT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TYFAVLM-NH2
Peptide H-TYFAVLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-YGGFLRRIRPKLK-OH
Peptide LCBiot-YGGFLRRIRPKLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVDVEEQQLEESGPHDLTETSYLPR^-OH
Peptide H-VVDVEEQQLEESGPHDLTETSYLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Pal-KVK-OH
Peptide Pal-KVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGSEAYNQQLSEK^-OH
Peptide H-IGSEAYNQQLSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Boc-D-Ala-OH
CAS :Boc-D-Ala-OH is a chiral amino acid that can be used in the synthesis of peptides. Boc-D-Ala-OH is a building block for the synthesis of amino acids, and it can also be used as a ligand to form metal complexes. This product has been shown to be effective in reducing optical activity through chemoenzymatic reduction processes. Boc-D-Ala-OH has also been shown to be hydrolyzed by various enzymes, including alcohols and acrylates.
Formule :C8H15NO4Degré de pureté :Min. 95%Masse moléculaire :189.21 g/molAc-QQRFEWEFEQQ-NH2
Peptide Ac-QQRFEWEFEQQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formule :C72H98O22N20Masse moléculaire :1,595.7 g/molH-DALSSVQESQVAQQ^AR-OH
Peptide H-DALSSVQESQVAQQ^AR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
rec Oncostatin M (human)
CAS :Please enquire for more information about rec Oncostatin M (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%H-Ser-Phe-Asn-Gly-Gly-Pro-NH2
CAS :H-Ser-Phe-Asn-Gly-Gly-Pro-NH2 is a peptide that activates Protease Activated Receptor 1 (PAR1) and Protease Activated Receptor 3 (PAR3). It also has been shown to decrease blood pressure in mice, inhibit coagulation, and increase the breakdown of fibrin clots. This product is a ligand for PAR1 and PAR3. It has been shown to activate these receptors by binding to them through its amino acid sequence. HSPNP binds to proteases that cleave the peptide from the receptor, which leads to activation of the receptor. HSPNP can also bind to PAR3 and PAR4.
Formule :C25H36N8O8Degré de pureté :Min. 95%Masse moléculaire :576.61 g/molH-VITKPFTK^-OH
Peptide H-VITKPFTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YWGVASFLQK^-OH
Peptide H-YWGVASFLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ser-Phe-Leu-Leu-Arg-NH2
CAS :H-Ser-Phe-Leu-Leu-Arg-NH2 is a peptide that contains a cyclic backbone with aromatic residues. It has been shown to enhance the release of catecholamines from rat striatal slices and to inhibit platelet activation by thrombin receptor. It is also an agonist at the thrombin receptor and has been found to be effective in inhibiting the proteolytic activity of serine proteases such as thrombin, trypsin, and elastase. This peptide exhibits conformational properties that are favorable for interaction with protein receptors.
Formule :C30H51N9O6Degré de pureté :Min. 95%Masse moléculaire :633.78 g/molFA-Gly-Leu-Ala-OH TFA
CAS :FA-Gly-Leu-Ala-OH TFA is a high quality reagent that can be used for the synthesis of complex compounds. It is an intermediate for the production of fine chemicals and speciality chemicals, which are used as reaction components in the synthesis of versatile building blocks. This compound is also an excellent scaffold for research chemicals and useful as a building block in the synthesis of speciality chemicals.Formule :C18H25N3O6•TFADegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :493.43 g/molH-IGGHGAEYGAEALER^-OH
Peptide H-IGGHGAEYGAEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LHGGSPWPPCQYR^-OH
Peptide H-LHGGSPWPPCQYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EITFHGAK^-OH
Peptide H-EITFHGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CGP 42112
CAS :CGP 42112 is a peptide that inhibits the binding of ligands to their receptors. It has been shown to be an effective inhibitor of protein interactions and has been used in research tools for the study of protein-protein interactions. CGP 42112 is an activator of the Ligand-gated ion channels and can be used as an antibody for receptor detection. This compound has a high purity with a CAS number 127060-75-7.Formule :C52H69N13O11Degré de pureté :Min. 95%Masse moléculaire :1,052.2 g/molH-VLGAFSDGLAHLDNLK^^-OH
Peptide H-VLGAFSDGLAHLDNLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-WAKW-NH2
Peptide Ac-WAKW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CQLINTNGSWHINCK-NH2
Peptide Ac-CQLINTNGSWHINCK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Enfuvirtide
CAS :TFA salt. Enfuviritide is a bicyclic heterocycle that is used in the treatment of HIV/AIDS. It binds to the HIV-1 envelope protein, preventing it from binding to CD4+ cells and infecting them. Enfuviritide has been shown to be effective at increasing the levels of active antiretroviral therapy and has shown significant cytotoxicity against HIV-1 and other infectious viruses. This drug also inhibits viral life by binding to the viral envelope protein gp120 and preventing it from binding to CD4+ cells. However, this drug may have long-term toxicity and may cause drug interactions with other drugs that are metabolized by cytochrome P450 enzymes. Enfuviritide has inhibitory properties against a wide range of antimicrobial agents including Gram-positive bacteria, Gram-negative bacteria, fungi, protozoa, and enveloped viruses.
Formule :C204H301N51O64Degré de pureté :Min. 95%Masse moléculaire :4,491.98 g/molH-IPAMVVDR^-OH
Peptide H-IPAMVVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-NIQLINTNGSWHINST-NH2
Peptide Ac-NIQLINTNGSWHINST-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.For-MAIVGTIIKIIKAIIDIFAK-OH
Peptide For-MAIVGTIIKIIKAIIDIFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGNGVWIGR^-OH
Peptide H-YGNGVWIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KRFKQDGGWSHWSPWSSC-NH2
Peptide Ac-KRFKQDGGWSHWSPWSSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
pE-LYENKPRRP^YIL^
pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormule :C73H116N20O18Masse moléculaire :1,561.84 g/molUDP-β-L-Rhamnose
CAS :UDP-β-L-Rhamnose is a pentose sugar that is used as a research tool and an activator. It has been shown to be an inhibitor of ion channels and protein interactions, as well as a ligand for certain receptors. This compound has high purity and can be used in the study of cell biology, pharmacology, and immunology.
Formule :C15H24N2O16P2Degré de pureté :Min. 95%Masse moléculaire :550.3 g/molH-LNNISIIGPLDMK^-OH
Peptide H-LNNISIIGPLDMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Delicious peptide (bovine) trifluoroacetate
CAS :Delicious peptide (bovine) trifluoroacetate is a polymerase chain reaction probe that is complementary to the 3' end of the human insulin gene. When used in a polymerase chain reaction, it amplifies the DNA sequences at the 3' end of the gene. The product of this amplification has been shown to inhibit genetic disorders such as metabolic disorders, iron homeostasis, and leukemia. This agent also inhibits acidic fibroblast proliferation and pluripotent cells. This drug has been shown to have a molecular docking analysis with pharmacological agents and may be helpful in treatments for various diseases.Formule :C34H57N9O16•(C2HF3O2)xDegré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :847.87 g/molHepcidin-25 (human) trifluoroacetate salt
CAS :Please enquire for more information about Hepcidin-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C113H170N34O31S9·C2HF3O2Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :2,903.38 g/molH-QLSESQVK^-OH
Peptide H-QLSESQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YYQQLK^-OH
Peptide H-YYQQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CSCSSLMDKECVY^FCHLDIIW^VNTPEHVVPYGL^GSPRS-OH
H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-IQVYSR^-OH
Peptide H-IQVYSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GSLFFFPLPLLIK^-OH
Peptide H-GSLFFFPLPLLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLANVSTVLTSK^-OH
Peptide H-FLANVSTVLTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVASGVVVVAAAGNEGTSGGSSTVGYPGK^-OH
Peptide H-AVASGVVVVAAAGNEGTSGGSSTVGYPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TYLPAVDEK^-OH
Peptide H-TYLPAVDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Boc-Gln-Gly-Arg-AMC·HCl
CAS :Boc-Gln-Gly-Arg-AMC·HCl is a reagent that is used as a reaction component in the synthesis of peptides, antibiotics, and other complex compounds. Boc-Gln-Gly-Arg-AMC·HCl is also a useful scaffold for the synthesis of new fine chemicals. This chemical has a CAS number of 133448-21-2, and is classified as a speciality chemical and versatile building block. It can be used to synthesize various fine chemicals with high purity and quality.Formule :C28H40N8O8·HClDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :653.13 g/molH-GFYPSDIAVEWESNGQPENNYK^-OH
Peptide H-GFYPSDIAVEWESNGQPENNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peptide YY (Dog, Mouse, Porcine, Rat, 3-36)
CAS :PYY (3-36), a Y2 receptor agonist, is released from the body's gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which suggests that PYY (3-36) has a role in 'longer term' regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drugs for the treatment of obesity. This product is available as an Acetate salt.Formule :C176H272N52O54Degré de pureté :Min. 95%Masse moléculaire :3,980.45 g/molAoa-DYKDDDDK-OH
Peptide Aoa-DYKDDDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAVVGVGDESR^-OH
Peptide H-GAVVGVGDESR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Gly-Leu-Gly-OH
CAS :Gly-Leu-Gly is a peptide that has a conformation in which the side chain of the amino acid glycine is attached to the alpha-carbon atom of the amino acid leucine. It is a labile molecule, meaning that it can react with other molecules or break down spontaneously. Gly-Leu-Gly is also called glycylleucine. This peptide has been found to have protonation properties that depend on temperature and kinetic energy. The carbonyl group of this peptide interacts with other molecules by donating or accepting electrons. In addition, this compound can be analyzed using spectrometers and gas chromatographs.Formule :C10H19N3O4Masse moléculaire :245.28 g/molH-Leu-Tyr-OH
CAS :H-Leu-Tyr-OH is a biphasic response amide with two phenyl groups and a primary amino group. It is most active at pH 6.5, but can be used at higher or lower pHs. The rate of H-Leu-Tyr-OH formation is highest in triticum aestivum (wheat) butyric acid extract. H-Leu-Tyr-OH has been shown to have excitatory effects on plant physiology, which may be due to its ability to bind to the specific antibody against acetylcholine receptors.Formule :C15H22N2O4Masse moléculaire :294.35 g/molH-IDIDIER^-OH
H-IDIDIER-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-EVGDWRK^-OH
Peptide H-EVGDWRK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPVSDR^-OH
Peptide H-TPVSDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CRAELEKHGYKMETS
Ac-CRAELEKHGYKMETS is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolSIVmac239 - 106
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,688 g/molH-GDVTAQIALQPALK^-OH
Peptide H-GDVTAQIALQPALK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Asp(Ala-OH)-OH
CAS :H-Asp(Ala-OH)-OH is an amino acid that has been found to be selectively active in the cerebral cortex. It has a high affinity for the cerebral cortex, with a Kd of 1.5 nM and a brain tissue concentration of 3.3 µg/g. H-Asp(Ala-OH)-OH has been shown to have neuroprotective effects against hypoxia, glutamate toxicity, and oxygen deprivation. This compound reverses the effects of oxidative stress in cultured cells and can also stimulate protein synthesis in cultured cells. The mechanism by which it works is not yet known but may involve inhibition of cysteine uptake into the cell or stimulation of protein synthesis by increasing intracellular levels of cAMP.Formule :C7H12N2O5Degré de pureté :Min. 95 Area-%Couleur et forme :White PowderMasse moléculaire :204.18 g/molMelanocyte Protein PMEL 17 (44-59) (human, bovine, mouse)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C95H137N27O28Masse moléculaire :2,105.3 g/molH-GLSPTVWLSV^-OH
Peptide H-GLSPTVWLSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DMQLGR^-OH
Peptide H-DMQLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.OVA Peptide (257-264)
CAS :SIINFEKL sequence.OVA Peptide (257-264) is a fragment of the OVA protein that stimulates an antibody response. It has been shown to activate various types of immune cells, such as T-cells, B-cells and macrophages.
Formule :C45H74N10O13Degré de pureté :Min. 95%Masse moléculaire :963.15 g/molH-Gly-Phe-AMC
CAS :H-Gly-Phe-AMC is a synthetic substrate that is used in homogeneous enzyme assays. This product has been shown to have inhibitory properties against proteolytic enzymes such as peptidases, which are enzymes that break down proteins. H-Gly-Phe-AMC is also reactive with collagen and has been shown to be useful in the study of biochemical properties of peptide hormones.Formule :C21H21N3O4Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :379.41 g/molH-R^LITGRLQSL-OH
Peptide H-R^LITGRLQSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGFLHSGTAK^-OH
Peptide H-LGFLHSGTAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Myelin PLP (139-151) acetate
CAS :Myelin PLP (139-151) acetate salt is a cyclic peptide that is derived from the sequence of human myelin basic protein and contains the sequence PLP (139-151). This peptide has shown to have antioxidative properties. It has been shown to have an inhibitory effect on the production of proinflammatory cytokines in experimental autoimmune encephalomyelitis (EAE), which is a model for multiple sclerosis. The peptide has also been shown to block signal pathways, such as toll-like receptor 4, and decrease Ca2+ overload. Clinical relevance remains unclear.
Formule :C72H104N20O17•(C2H4O2)xDegré de pureté :Min. 95%Masse moléculaire :1,521.76 g/molH-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH
H-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormule :C275H477N125O51Masse moléculaire :6,350.54 g/molH-LDSIICVK^-OH
Peptide H-LDSIICVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VYIHP^F-OH
Peptide H-VYIHP^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SSVSDYVNYDIIVR^-OH
Peptide H-SSVSDYVNYDIIVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHVGDEDFVHLR^-OH
Peptide H-VHVGDEDFVHLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IAPQLSTEELVSLGEK^-OH
Peptide H-IAPQLSTEELVSLGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELVSEFSR^-OH
Peptide H-ELVSEFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPSVFPLAPSSR^-OH
Peptide H-GPSVFPLAPSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SNLELLR^-OH
Peptide H-SNLELLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.TNF α Human
CAS :TNF-α is a cytokine that has been shown to be a potent inducer of tumor necrosis. It also promotes the activation of macrophages, neutrophils, and endothelial cells. TNF-α is produced by many different cell types, but most notably by activated macrophages and lymphocytes. TNF-α is secreted from these cells in response to stimulation with lipopolysaccharide or other agents such as LPS, IL1β, or CD40 ligand. The protein encoded by this gene is an important cytokine for the immune system.
Degré de pureté :Min. 95%H-EVTVDTTLAGYHLPK^-OH
Peptide H-EVTVDTTLAGYHLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVINGNPITIFQER^-OH
Peptide H-LVINGNPITIFQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TENNDHINLK^-OH
Peptide H-TENNDHINLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fluor-SIINFEKLGSGHWDFAWPW-OH
Peptide Fluor-SIINFEKLGSGHWDFAWPW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPEQTQGNFGDQELIR^-OH
Peptide H-GPEQTQGNFGDQELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYFPHFDVSHGSAQVK^-OH
Peptide H-TYFPHFDVSHGSAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PAR-3 (1-6) amide (human)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C29H46N10O7Masse moléculaire :646.75 g/molH-YTPVGR^-OH
Peptide H-YTPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTFIIDPGGVIR^-OH
Peptide H-GTFIIDPGGVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VHLTPE^EKS-OH
Peptide H-VHLTPE^EKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QQTVGGVNYFFDVEVGR^-OH
Peptide H-QQTVGGVNYFFDVEVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TWNDPSVQQDI^K^-OH
Peptide H-TWNDPSVQQDI^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SELEEQLTPVAEETR^-OH
Peptide H-SELEEQLTPVAEETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RERQR-OH
Peptide Ac-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DGVPVIK^-OH
Peptide H-DGVPVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QTISNACGTIGLIHAIANNK^-OH
Peptide H-QTISNACGTIGLIHAIANNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SEVAHR^-OH
Peptide H-SEVAHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISTLNSLTLPALR^-OH
Peptide H-ISTLNSLTLPALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YMLDL^QPETT-OH
Peptide H-YMLDL^QPETT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Alpha-Mating Factor
CAS :Alpha-Mating Factor is a peptide that belongs to the group of ligands. It has been shown to bind to the androgen receptor with high affinity and act as an activator for this receptor. Alpha-Mating Factor is also able to bind to the beta-adrenergic receptor. This protein has been shown to have ion channel activity, which may be due to its inhibition of potassium channels. Alpha-Mating Factor is used in research as a tool for studying cell biology and cell signalling pathways.
Formule :C82H114N20O17SDegré de pureté :Min. 95%Masse moléculaire :1,684 g/molH-DANISQPETTK^-OH
Peptide H-DANISQPETTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-82/aa325 - 339
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,554.8 g/molH-NVDLSTFYQNR^-OH
Peptide H-NVDLSTFYQNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IRPFF^PQ-OH
Peptide H-IRPFF^PQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-SGRGKGGKGLGKGGAKRHRKV-NH2
Peptide LCBiot-SGRGKGGKGLGKGGAKRHRKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GFQALGDAADIR^-OH
Peptide H-GFQALGDAADIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PTH-rP (Human, 7-34 Amide)
CAS :PTH-rP (Human, 7-34 Amide), sourced from rat, and mouse and available as a 0.5mg vial, is an antagnoist of the A Parathyroid Hormone related Peptide (PTH-rP). PTH-rP is a peptide that belongs to the group of activators. PTH-rP has been shown to activate phospholipase C, which leads to increased intracellular calcium levels and activation of protein kinase C. PTH-rP also binds to the receptor for parathyroid hormone (PTH), and activates it by binding to its extracellular domain. This receptor is found in most cells in the body, including those in bone, kidney, gut and brain. The ligand-receptor interaction causes an increase in intracellular calcium levels that triggers a cascade of downstream effects on cell metabolism and gene expression.Formule :C153H247N49O37Degré de pureté :Min. 95%Masse moléculaire :3,364.9 g/molH-VGDTSLDPNDFDFTVTGR^-OH
Peptide H-VGDTSLDPNDFDFTVTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGTQFIR^-OH
Peptide H-VGTQFIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MBP (63-81)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,645.1 g/molCyclo(-D-Leu-D-Pro)
CAS :Cyclo(-D-Leu-D-Pro) is a macrolide that inhibits the growth of bacteria. It binds to the 50S ribosomal subunit and prevents the formation of an antibiotic-inhibitor complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. Cyclo(-D-Leu-D-Pro) has been shown to have antibacterial activity against the Gram negative bacterium Vibrio anguillarum. This drug has also been shown to have endophytic properties, as it was isolated from an endophytic fungus found in leaves of Eucalyptus trees. The stereoisomers of cyclo(-D-Leu-D-Pro) have different effects on bacterial cells, with one being more potent than the other.Formule :C11H18N2O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :210.27 g/molAc-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2
CAS :Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2 is an enzyme substrate that acts as a competitive inhibitor of the hepatitis C protease. It has been shown to inhibit the activity of the hepatitis C protease in cell culture, and can be used to identify other inhibitors of this protease. Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2 is a peptide with an amino acid sequence that is not found in any known proteins.
Formule :C68H89N15O25SDegré de pureté :Min. 95%Masse moléculaire :1,548.62 g/molFluor-GSRAHSSHLKSKKGQSTSRHKK-OH
Peptide Fluor-GSRAHSSHLKSKKGQSTSRHKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LITTQQWLIK^-OH
Peptide H-LITTQQWLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tertiapin-Q trifluoroacetate salt
CAS :A peptide found in honey bee venom; Potassium channel inhibitorFormule :C106H175N35O24S4Degré de pureté :Min. 95%Masse moléculaire :2,452.01 g/molH-FQTLLALHR^-OH
Peptide H-FQTLLALHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDLIAEVETDK^ATV-OH
Peptide H-GDLIAEVETDK^ATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Phe-Trp-OH
CAS :H-Phe-Trp-OH is an inhibitor of protein phosphatase 2A and is used in the diagnosis of kidney cancer. Magnetic resonance spectroscopy (MRS) is a technique that can be used to measure the concentration of phosphate groups in tissues. Hypophosphatemia, or low phosphate levels in the body, is associated with a number of diseases, including kidney cancer. This molecule inhibits the activity of phosphatase 2A and can be used as a diagnostic marker for such conditions. The enzyme has been shown to have an inhibitory effect on vitamin D3-induced synthesis of calcitriol (1,25-dihydroxyvitamin D3), which may be due to its ability to sequester phosphate groups. H-Phe-Trp-OH binds to proteins and has been shown to have an inhibitory effect on other enzymes such as histidine phosphatase and glutamine phosphatase.
Formule :C20H21N3O3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :351.4 g/molH-GQVLVFLGQSEGLR^-OH
Peptide H-GQVLVFLGQSEGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDAQASFLPK^-OH
Peptide H-LDAQASFLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TITLEVESSDTIDNVK^-OH
Peptide H-TITLEVESSDTIDNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tertiapin
CAS :Tertiapin is a synthetic bee venom peptide (Honey Bee, Apis mellifera) containing disulfide bonds between Cys3-Cys14 and Cys5-Cys18. It is an inward rectifier K+ channel blocker and also blocks the activity of calcium activated large conductance potassium channels. The pain and inflammation symptoms experienced after a bee sting is caused by this peptide even though bee venom also has the potential to treat pain and inflammation in conditions such as rheumatoid arthritis and multiple sclerosis.Formule :C106H180N34O23S5Degré de pureté :Min. 95%Masse moléculaire :2,459.11 g/molH-VLELTSDNDR^-OH
Peptide H-VLELTSDNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GIYQTSNFR^-OH
Peptide H-GIYQTSNFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-KETWWETWWTEWSQPKKKRKVC-NH2
Peptide Fluor-KETWWETWWTEWSQPKKKRKVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-L^NILNNNYK^-OH
Peptide H-L^NILNNNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLNVTLSSTGR^-OH
Peptide H-GLNVTLSSTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNMLNNNYK^^-OH
Peptide H-LNMLNNNYK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-A^^G^^G-OH
Peptide H-A^^G^^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YFLLRN-NH2
Peptide H-YFLLRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-AGFAGDDAP-NH2
Peptide Ac-AGFAGDDAP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IPVALGLK^-OH
Peptide H-IPVALGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SPSYSPTSPS-NH2
Peptide Ac-SPSYSPTSPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LANDAAQVK^-OH
Peptide H-LANDAAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NGFFF-NH2
Peptide H-NGFFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTPPVLDSDGSFFLYSK^-OH
Peptide H-TTPPVLDSDGSFFLYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Couleur et forme :PowderMasse moléculaire :1,882.05 g/molH-ASTIEMPQQAR^-OH
Peptide H-ASTIEMPQQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NNNN-NH2
Peptide H-NNNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-R^PKPQQFFGLM-OH
Peptide H-R^PKPQQFFGLM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPDATPK^-OH
Peptide H-LPDATPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GILTLK^-OH
Peptide H-GILTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-ASHLGLAR-OH
Peptide Ac-ASHLGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-R^PHFPQFSYSASGTA-OH
Peptide H-R^PHFPQFSYSASGTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FSVYWAQADR-NH2
Peptide H-FSVYWAQADR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Angiotensin II, ala(8)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C44H67N13O12Masse moléculaire :970.1 g/molH-LNDTTLQVLNTWYTK^-OH
Peptide H-LNDTTLQVLNTWYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LITLAIPVNKPGR^-OH
Peptide H-LITLAIPVNKPGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPYVITGPGVVEYK^-OH
Peptide H-SPYVITGPGVVEYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Diprotin A
CAS :Diprotin A is a peptide that is involved in cell signaling and has been shown to interact with ion channels and receptors. It is an activator of the Fc receptor, which is responsible for the activation of immune cells. This peptide can also be used as a research tool to study protein interactions or as an antibody to study ligands or receptors. Diprotin A can be used in the pharmacological treatment of diseases such as cancer, inflammation, and pain.
Formule :C17H31N3O4Degré de pureté :Min. 95%Masse moléculaire :341.45 g/molH-KIQEILTQVK^-OH
Peptide H-KIQEILTQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FVFGTTPEDILR^-OH
Peptide H-FVFGTTPEDILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
