Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29863 produits trouvés pour "Peptides"
H-PYNK-OH
Peptide H-PYNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IQQDPALPTREGKER-OH
Peptide H-IQQDPALPTREGKER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RKLPDAPGMHTW-OH
Peptide H-RKLPDAPGMHTW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VSGLEQLESIINFEKLTEWTSSNVM-OH
Peptide H-VSGLEQLESIINFEKLTEWTSSNVM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLEWVGWINTYTGEPTYAADFK-OH
Peptide H-GLEWVGWINTYTGEPTYAADFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YESIRIGVAPSQ-OH
Peptide H-YESIRIGVAPSQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLQDSVDFSLADAINTEFK-OH
Peptide H-LLQDSVDFSLADAINTEFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KCRAKFKQL-OH
Peptide H-KCRAKFKQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NLFLNHSENATAK-OH
Peptide H-NLFLNHSENATAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TMFPHIIVDV-OH
Peptide H-TMFPHIIVDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Masse moléculaire :1,171.4 g/molH-FLEEL-OH
Peptide H-FLEEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPYPQP-OH
Peptide H-LPYPQP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GDKR-OH
Peptide H-GDKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TLDFHDSNVK-OH
Peptide H-TLDFHDSNVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILEDIVLTL-OH
Peptide H-ILEDIVLTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FFGAIAGFL-OH
Peptide H-FFGAIAGFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LMVGGVV-OH
Peptide H-LMVGGVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TQNILLDNEFHVK-OH
Peptide H-TQNILLDNEFHVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Adipophilin
Peptide Adipophilin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formule :C35H63N9O14Masse moléculaire :833.94 g/molH-HAIYPRH-OH
Peptide H-HAIYPRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIVLTQSPGTLSLSPGER-OH
Peptide H-EIVLTQSPGTLSLSPGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WPTLQWA-OH
Peptide H-WPTLQWA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EMTPVNPG-OH
Peptide H-EMTPVNPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HCLGKWLGHPDKF-OH
Peptide H-HCLGKWLGHPDKF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RIQRGPGRAFVTIGK-OH
Peptide H-RIQRGPGRAFVTIGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPSWEPFR-OH
Peptide H-SPSWEPFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KQNPDIVIY-OH
Peptide H-KQNPDIVIY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TLIGDCATV-OH
Peptide H-TLIGDCATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQSEVSAAQLQER-OH
Peptide H-GQSEVSAAQLQER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KCSRNRQYL-OH
Peptide H-KCSRNRQYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-THLR-OH
Peptide H-THLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNVTEQEK-OH
Peptide H-LNVTEQEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLPKINRKGPRPPGFSPFR-OH
Peptide H-DLPKINRKGPRPPGFSPFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILGNQGSFLTK-OH
Peptide H-ILGNQGSFLTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FVTLVFR-OH
Peptide H-FVTLVFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASNENVETM-OH
Peptide H-ASNENVETM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PSKPSFQEFVDWENVSPELNSTDQPFL-OH
Peptide H-PSKPSFQEFVDWENVSPELNSTDQPFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FSISWAR-OH
Peptide H-FSISWAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPLRPMTY-OH
Peptide H-VPLRPMTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PYILNKKAI-OH
Peptide H-PYILNKKAI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CLAVEEVSL-OH
Peptide H-CLAVEEVSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FQTKGLGISY-OH
Peptide H-FQTKGLGISY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EALALALDQER-OH
Peptide H-EALALALDQER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RPKPQQFFGLM-OH
Peptide H-RPKPQQFFGLM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SYPSNATCPR-OH
Peptide H-SYPSNATCPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLTLHLK-OH
Peptide H-GLTLHLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LYDLLLEML-OH
Peptide H-LYDLLLEML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SHGQDYLVGNK-OH
Peptide H-SHGQDYLVGNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FRDYVDRFYKTLRAEQASQD-OH
Peptide H-FRDYVDRFYKTLRAEQASQD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CALNNK-OH
Peptide H-CALNNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SAPDNRPAL-OH
Peptide H-SAPDNRPAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ERGVT-OH
Peptide H-ERGVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EALYLVCGE-OH
Peptide H-EALYLVCGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YPSKPD-OH
Peptide H-YPSKPD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLELYSQK-OH
Peptide H-VLELYSQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTSEGAGLQLQK-OH
Peptide H-VTSEGAGLQLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LDETVVNR-OH
Peptide H-LDETVVNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNKIVRMYSPTSILD-OH
Peptide H-LNKIVRMYSPTSILD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LEQLESIINFEKLTEWTS-OH
Peptide H-LEQLESIINFEKLTEWTS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-APEEILAEK-OH
Peptide H-APEEILAEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LKEFGNTLEDK-OH
Peptide H-LKEFGNTLEDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CTFEYVSQPFLMDLE-OH
Peptide H-CTFEYVSQPFLMDLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TP-OH
Peptide H-TP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WGIDKAFFTTSTVTYKWFRY-OH
Peptide H-WGIDKAFFTTSTVTYKWFRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SHFANLK-OH
Peptide H-SHFANLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASQDVNTAVAWYQQKPGK-OH
Peptide H-ASQDVNTAVAWYQQKPGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DVLTITLTPK-OH
Peptide H-DVLTITLTPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTGVEEGRLIFDNLKKC-OH
Peptide H-VTGVEEGRLIFDNLKKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VPSPSMGRDIKVQFQSGGAN-OH
Peptide H-VPSPSMGRDIKVQFQSGGAN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKAKAK-OH
Peptide H-AKAKAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EPE-OH
Peptide H-EPE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILKEPVHGV-OH
Peptide H-ILKEPVHGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVSEDFLQDVSASTK-OH
Peptide H-VVSEDFLQDVSASTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WIPYFGPAAEGIYTE-OH
Peptide H-WIPYFGPAAEGIYTE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLPMSPR-OH
Peptide H-DLPMSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR-OH
Peptide H-SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IHRIC-OH
Peptide H-IHRIC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EPLPQGQLTAY-OH
Peptide H-EPLPQGQLTAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KALGPAATL-OH
Peptide H-KALGPAATL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PLSMVGPSQGRSPSYAS-OH
Peptide H-PLSMVGPSQGRSPSYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLDDFAMHWV-OH
Peptide H-TLDDFAMHWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IEIYPTSLTK-OH
Peptide H-IEIYPTSLTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQ-OH
Peptide H-TSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KKANELIAYLKQATK-OH
Peptide H-KKANELIAYLKQATK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QQTVTLLPAADLDDFSK-OH
Peptide H-QQTVTLLPAADLDDFSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLTWQELYQLKYKGI-OH
CAS :Peptide H-KLTWQELYQLKYKGI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formule :C92H143N21O23Masse moléculaire :1,911.25 g/molH-KEVNSQLSL-OH
Peptide H-KEVNSQLSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LAVEEVSLRK-OH
Peptide H-LAVEEVSLRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CLTSTVQLV-OH
Peptide H-CLTSTVQLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVAQGVGIPEDSIFTMADR-OH
Peptide H-VVAQGVGIPEDSIFTMADR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALILTLVS-OH
Peptide H-ALILTLVS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALGFENATQALGR-OH
Peptide H-ALGFENATQALGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YTFELSR-OH
Peptide H-YTFELSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ITCPPPMSVEHADIWVK-OH
Peptide H-ITCPPPMSVEHADIWVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EITFHGAK-OH
Peptide H-EITFHGAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SFGSGFGGGY-OH
Peptide H-SFGSGFGGGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RGARRMAIL-OH
Peptide H-RGARRMAIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GKSLYESWTKK-OH
Peptide H-GKSLYESWTKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SPSYAYHQF-OH
Peptide H-SPSYAYHQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formule :C52H64N12O14Masse moléculaire :1,099.15 g/molH-YLAEVATGEK-OH
Peptide H-YLAEVATGEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LVLQTM-OH
Peptide H-LVLQTM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NNTRKSIHIGPGRAF-OH
Peptide H-NNTRKSIHIGPGRAF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SRTPSLPTPPTREPK-OH
Peptide H-SRTPSLPTPPTREPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVNLPGAAVDLPAVSEK-OH
Peptide H-GVNLPGAAVDLPAVSEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTGEVLDILTR-OH
Peptide H-VTGEVLDILTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVTLSLDGGDTAIR-OH
Peptide H-AVTLSLDGGDTAIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FNKPFVFLMIEQNTK-OH
Peptide H-FNKPFVFLMIEQNTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TFFYGGSRGKRNNFKTEEYC-OH
Peptide H-TFFYGGSRGKRNNFKTEEYC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FCIGRL-OH
Peptide H-FCIGRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NEQEQPLGQWHLS-OH
Peptide H-NEQEQPLGQWHLS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GAQASPPPIAPYPSPTR-OH
Peptide H-GAQASPPPIAPYPSPTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CHHHHHHHHHH-OH
Peptide H-CHHHHHHHHHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KSDICTDEY-OH
Peptide H-KSDICTDEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ETEVIDPQDLLEGR-OH
Peptide H-ETEVIDPQDLLEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AAFEFINSL-OH
Peptide H-AAFEFINSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSRRR-OH
Peptide H-SSRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KKKLPATGDYMNMSPVGD-OH
Peptide H-KKKLPATGDYMNMSPVGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QYIHSANVL-OH
Peptide H-QYIHSANVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NTYDVVYLK-OH
Peptide H-NTYDVVYLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELPEHTVK-OH
Peptide H-ELPEHTVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VSVNSTLQSGLRKMA-OH
Peptide H-VSVNSTLQSGLRKMA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KALN-OH
Peptide H-KALN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AFVDFLSDEIK-OH
Peptide H-AFVDFLSDEIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DILLTQSPAILSVSPGER-OH
Peptide H-DILLTQSPAILSVSPGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SRLSKVAPVIKARMMEYGTT-OH
Peptide H-SRLSKVAPVIKARMMEYGTT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLFNKVTLA-OH
Peptide H-LLFNKVTLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DRLPKSDSEDGPRALNQLSLC-OH
Peptide H-DRLPKSDSEDGPRALNQLSLC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WNEKYAQAYPNVS-OH
Peptide H-WNEKYAQAYPNVS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FPQGKAREF-OH
Peptide H-FPQGKAREF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RINSAKDDAAGLQIA-OH
Peptide H-RINSAKDDAAGLQIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVVEVDESGTR-OH
Peptide H-AVVEVDESGTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CDFLIEEIERLGQDL-OH
Peptide H-CDFLIEEIERLGQDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DPPD-OH
Peptide H-DPPD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LVCGERGFFY-OH
Peptide H-LVCGERGFFY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLDFAPPGA-OH
Peptide H-VLDFAPPGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GKDPNYRDEAIRSIE-OH
Peptide H-GKDPNYRDEAIRSIE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLQLDEETGEFL-OH
Peptide H-QLQLDEETGEFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QRPIFIITEYMANGCLLNYLR-OH
Peptide H-QRPIFIITEYMANGCLLNYLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KTTKQSFDL-OH
Peptide H-KTTKQSFDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GQPDAGLFTVSEAEC-OH
Peptide H-GQPDAGLFTVSEAEC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ESKVDPSK-OH
Peptide H-ESKVDPSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLEDLQLTHNK-OH
Peptide H-SLEDLQLTHNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLLEYLEEK-OH
Peptide H-LLLEYLEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EAWGALANWAVDSA-OH
Peptide H-EAWGALANWAVDSA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EIQNAVNGVK-OH
Peptide H-EIQNAVNGVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSSSIINFEKL-OH
Modified H-2kb tetramer peptide for further modification (e.g. addition of N-term tag)H-TPTE-OH
Peptide H-TPTE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SHRPPPPGHRV-OH
Peptide H-SHRPPPPGHRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FSPDDSAGASALLR-OH
Peptide H-FSPDDSAGASALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EKAFSPEVIPMFSAL-OH
Peptide H-EKAFSPEVIPMFSAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TAMDVVYAL-OH
Peptide H-TAMDVVYAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLAPYAQDTQEK-OH
Peptide H-SLAPYAQDTQEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QPRYPVNSV-OH
Peptide H-QPRYPVNSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TPP-OH
Peptide H-TPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NLYDKAGKV-OH
Peptide H-NLYDKAGKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLCPHCINV-OH
Peptide H-GLCPHCINV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KCRGKVPGKYGKG-OH
Peptide H-KCRGKVPGKYGKG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
1-(3-Dimethylaminopropyl)-3-ethylcarbodiimide
CAS :Formule :C8H17N3Degré de pureté :>98.0%(GC)(T)Couleur et forme :Colorless to Yellow clear liquidMasse moléculaire :155.25H-EMLIKPKEL-OH
Peptide H-EMLIKPKEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Nα-[(9H-Fluoren-9-ylmethoxy)carbonyl]-N1-tert-butoxycarbonyl-L-tryptophan
CAS :Formule :C31H30N2O6Degré de pureté :>97.0%(HPLC)Couleur et forme :White to Orange to Green powder to crystalMasse moléculaire :526.59H-DSATMHSSRYGYGYNC-OH
Peptide H-DSATMHSSRYGYGYNC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EAEDLQVGQVELG-OH
Peptide H-EAEDLQVGQVELG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FALSNAEDL-OH
Peptide H-FALSNAEDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IIPGGIYNADLNDEWVQR-OH
Peptide H-IIPGGIYNADLNDEWVQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HSQFIGYPITLFVEK-OH
Peptide H-HSQFIGYPITLFVEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-HHHHHH-OH
Peptide LCBiot-HHHHHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EFGNTLEDK-OH
Peptide H-EFGNTLEDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KAAYNFATM-OH
Peptide H-KAAYNFATM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RGDW-OH
Peptide H-RGDW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FMDGTMSQV-OH
Peptide H-FMDGTMSQV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TYQNKVVKVL-OH
Peptide H-TYQNKVVKVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTYEAYVRY-OH
Peptide H-YTYEAYVRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FDDF-OH
Peptide H-FDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AAGTVFTTVEDLGSKILLTC-OH
Peptide H-AAGTVFTTVEDLGSKILLTC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VEWLR-OH
Peptide H-VEWLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGMK-OH
Peptide H-VGMK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DPLNVLKPR-OH
Peptide H-DPLNVLKPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.KRAS (5-14) WT
Peptide H-KLVVVGAGGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLRGSPPPMAGG-OH
Peptide H-HLRGSPPPMAGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNIDLLWSV-OH
Peptide H-LNIDLLWSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RLASFYDWPL-OH
Peptide H-RLASFYDWPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILPTLEAVAALGNK-OH
Peptide H-ILPTLEAVAALGNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YGGFL-OH
Peptide H-YGGFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPYEGSLLLKLLRAPVEEV-OH
Peptide H-LPYEGSLLLKLLRAPVEEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.N-(tert-Butoxycarbonyl)-L-valine Methyl Ester
CAS :Formule :C11H21NO4Degré de pureté :>95.0%(T)(HPLC)Couleur et forme :Colorless to Light yellow to Light orange clear liquidMasse moléculaire :231.29H-PQPELPYPQ-OH
Peptide H-PQPELPYPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSPSFADLFR-OH•TFA
Peptide H-LSPSFADLFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C54H79N13O14•(C2HF3O2)xMasse moléculaire :1,152.30 g/molH-HLVDEPQNLIK-OH
Peptide H-HLVDEPQNLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Spadin
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C96H142N26O22Masse moléculaire :2,012.34 g/molH-GLMWLSYFI-OH
Peptide H-GLMWLSYFI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KAFSPEVIPMF-OH
Peptide H-KAFSPEVIPMF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ERSPVIQTL-OH
Peptide H-ERSPVIQTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIVKLTVYDCIRRRRRRRRR-OH
Peptide H-DIVKLTVYDCIRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELQLLMQSTPPTNNR-OH
Peptide H-ELQLLMQSTPPTNNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PRECESI-OH
Peptide H-PRECESI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NYTAPGGGQFTLPGR-OH
Peptide H-NYTAPGGGQFTLPGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVVGWPTVRERMRRA-OH
Peptide H-SVVGWPTVRERMRRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SFSTASAITPSVSR-OH
Peptide H-SFSTASAITPSVSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IPRRIRQGA-OH
Peptide H-IPRRIRQGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FPDENFK-OH
Peptide H-FPDENFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![Nα-[(9H-Fluoren-9-ylmethoxy)carbonyl]-N1-tert-butoxycarbonyl-L-tryptophan](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3B%2Fthumb-webp%2FF0507.webp&w=3840&q=75)
