CymitQuimica logo
Peptides

Peptides

Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.

Sous-catégories appartenant à la catégorie "Peptides"

30471 produits trouvés pour "Peptides"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • H-CSCSSWLDKECVY^FCHLDIIW^VNTPEQTAPYGL^GNPP-OH


    <p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>
  • H-GLDSEESYPYEAK^^-OH


    <p>Peptide H-GLDSEESYPYEAK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • HiGom


    <p>HiGom is a venom that belongs to the group of proteins that can produce reactive oxygen species. It has been shown to inhibit mitochondrial membrane potential, cellular viability, and the production of reactive oxygen species. HiGom has also been shown to inhibit the production of inflammatory cytokines and chemokines in response to chronic pain. This protein may be useful for cancer treatment as it has been shown to inhibit tumor growth by inducing apoptosis and inhibiting angiogenesis.</p>
    Formule :C92H150N38O23S4
    Degré de pureté :Min. 95%
    Masse moléculaire :2,284.72 g/mol
  • Glucagon-Like Peptide I (7-36), amide, human

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C149H226N40O45
    Masse moléculaire :3,297.7 g/mol
  • Val-Ile-Leu


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C17H33N3O4
    Masse moléculaire :343.46 g/mol
  • EBV BRLF-1 148-156 (HLA-A*03:01)

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :TKSVY2
    Masse moléculaire :1,143.3 g/mol
  • H-KLVVVGAVGV^-OH


    <p>Peptide H-KLVVVGAVGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • Lysine


    <p>Lysine peptide (Ac RFAAKAA COOH) is used in combination with cysteine peptide (Ac RFAACAA COOH) in the Direct Peptide Reactivity Assay (DPRA) test.<br>Direct Peptide Reactivity Assay is used in cosmetic applications for the characterization of the skin sensitizing potential of a substance, framed by OECD Guideline no 442.<br>The molecular initiating event (MIE) in skin sensitization is a binding between epidermal proteins and the sensitizing chemical substance. MIE is part of the adverse outcome pathway (AOP) of skin sensitization.<br>It is thanks to the properties of Lysine peptide and Cysteine peptide that the chemical binding will be able to take place, so these synthetic heptapeptides will mimic the reaction of a skin exposed to a substance.<br>Binding between nucleophilic proteins and electrophile substance will be measured by High Performance Liquid Chromatography (HPLC). Therefore, the decrease in Lysine peptide and Cysteine peptide levels will be a sign of sensitizing event. Depending on the rate of depletion, the sensitizing character of a molecule will be determined (see table at the bottom of the page).<br>In chemico DPRA test also has wider applications such as hazard classification in cosmetics, but also for pharmaceuticals and biocides. It is a good alternative to animal experimentation.</p>
    Formule :C35H57O9N11
    Masse moléculaire :775.9 g/mol
  • Thymosin β 4

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C212H350N56O78S
    Masse moléculaire :4,963.5 g/mol
  • Cyclo(Arg-Gly-Asp-D-Phe-Lys)

    CAS :
    <p>Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a synthetic peptide that binds to the integrin receptor on pancreatic cancer cells. It has been shown to be an effective diagnostic tool for pancreatic cancer and other cancers, such as prostate, breast, and lung. Cyclo(Arg-Gly-Asp-D-Phe-Lys) selectively binds to cells with high levels of integrin receptors by using "a heterofunctional approach." This technique is used in the synthesis of peptides because it increases the stability of peptides. Cyclo(Arg-Gly-Asp-D-Phe-Lys) can be used for diagnosis or therapeutic purposes.</p>
    Formule :C27H41N9O7
    Degré de pureté :Min. 95%
    Masse moléculaire :603.68 g/mol
  • Angiotensin I, human

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C62H89N17O14
    Masse moléculaire :1,296.5 g/mol
  • Apamin

    CAS :
    <p>SK channel blocker</p>
    Formule :C79H131N31O24S4
    Masse moléculaire :2,027.35 g/mol
  • Myelin Oligodendrocyte Glycoprotein(35-55), rat MOG(35-55)

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C118H177N35O29S
    Masse moléculaire :2,582 g/mol
  • Prostaglandin A1

    CAS :
    <p>Prostaglandin A1 is a bioactive lipid, which is derived from arachidonic acid through enzymatic pathways. It functions as a signaling molecule with various biological activities, influencing vascular tone, inflammation, and smooth muscle activity. Prostaglandins are a subset of eicosanoids, which are synthesized from essential fatty acids found within phospholipid membranes of cells.</p>
    Formule :C20H32O4
    Degré de pureté :Min. 95%
    Masse moléculaire :336.47 g/mol
  • H-NLDTASTTL-OH


    <p>Peptide H-NLDTASTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • H-NWAPGEPNNR-OH


    <p>Peptide H-NWAPGEPNNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • H-ALNRTSSDSALHRRR-OH


    <p>Peptide H-ALNRTSSDSALHRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALNRTSSDSALHRRR-OH include the following: Enhanced activation of cellular AMPK by dual-small molecule treatment: AICAR and A769662 S Ducommun , RJ Ford, L Bultot - American Journal , 2014 - journals.physiology.org<a href="https://journals.physiology.org/doi/abs/10.1152/ajpendo.00672.2013" target="_blank" rel="noreferrer noopener">https://journals.physiology.org/doi/abs/10.1152/ajpendo.00672.2013</a> Characterization of WZ4003 and HTH-01-015 as selective inhibitors of the LKB1-tumour-suppressor-activated NUAK kinases S Banerjee , SJ Buhrlage, HT Huang , X Deng - Biochemical , 2014 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/457/1/215/46906" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/457/1/215/46906</a> Interplay between Polo kinase, LKB1-activated NUAK1 kinase, PP1betaMYPT1 phosphatase complex and the SCFbetaTrCP E3 ubiquitin ligase S Banerjee , A Zagorska, M Deak - Biochemical , 2014 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/461/2/233/46874" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/461/2/233/46874</a> Inhibition of SIK2 and SIK3 during differentiation enhances the anti-inflammatory phenotype of macrophages NJ Darling , R Toth, JSC Arthur , K Clark - Biochemical Journal, 2017 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/474/4/521/49590" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/474/4/521/49590</a> Comparison of the specificity of Trk inhibitors in recombinant and neuronal assays KJ Martin, N Shpiro, R Traynor, M Elliott , JSC Arthur - Neuropharmacology, 2011 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0028390811001389" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0028390811001389</a> Enhanced activation of cellular AMPK by dual small GR Kemp, K Sakamoto - 2014 - journals.physiology.org<a href="https://journals.physiology.org/doi/prev/20140114-aop/epdf/10.1152/ajpendo.00672.2013" target="_blank" rel="noreferrer noopener">https://journals.physiology.org/doi/prev/20140114-aop/epdf/10.1152/ajpendo.00672.2013</a> The AMPK-related kinase SIK2 is regulated by cAMP via phosphorylation at Ser358 in adipocytes E Henriksson, HA Jones, K Patel , M Peggie - Biochemical , 2012 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/444/3/503/46279" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/444/3/503/46279</a></p>
  • H-GDSLAYGLR-OH


    <p>Peptide H-GDSLAYGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • H-MRWQEMGYIFYPRKLR-OH


    <p>Peptide H-MRWQEMGYIFYPRKLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • H-KLQVFLIVL-OH


    <p>Peptide H-KLQVFLIVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • H-VIYEQANAHGQ-OH


    <p>Peptide H-VIYEQANAHGQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • Nα-(tert-Butoxycarbonyl)-N1-formyl-L-tryptophan

    CAS :
    Formule :C17H20N2O5
    Degré de pureté :>98.0%(T)
    Couleur et forme :White to Light gray to Light yellow powder to crystal
    Masse moléculaire :332.36

    Ref: 3B-B2260

    Produit arrêté
  • H-VVSEDFLQDVSASTK-OH


    <p>Peptide H-VVSEDFLQDVSASTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • N-(tert-Butoxycarbonyl)-4-bromo-D-phenylalanine

    CAS :
    Formule :C14H18BrNO4
    Degré de pureté :>98.0%(HPLC)
    Couleur et forme :White to Almost white powder to crystal
    Masse moléculaire :344.21
  • H-VAANIVLTV-OH


    <p>Peptide H-VAANIVLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • H-TEFTTALQR-OH


    <p>Peptide H-TEFTTALQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • H-GYGFGLIK-OH


    <p>Peptide H-GYGFGLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • H-VYIHPF-OH


    <p>Peptide H-VYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • Amyloid β-Protein (1-42) TFA salt

    CAS :
    <p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease. TFA salt; 95%.</p>
    Formule :C203H311N55O60S
    Masse moléculaire :4,514.1 g/mol
  • 1-Benzyl-5-oxopyrrolidine-3-carboxylic Acid

    CAS :
    Formule :C12H13NO3
    Degré de pureté :>98.0%(GC)(T)
    Couleur et forme :White to Almost white powder to crystal
    Masse moléculaire :219.24

    Ref: 3B-B4264

    Produit arrêté
  • H-GPGGAWAAEVISNAR-OH


    <p>Peptide H-GPGGAWAAEVISNAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • H-DRFYKTLRAEQASQEV-OH


    <p>Peptide H-DRFYKTLRAEQASQEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • H-WHWLQLKPGQPMY-OH


    <p>Peptide H-WHWLQLKPGQPMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-WHWLQLKPGQPMY-OH include the following: Position one analogs of the Saccharomyces cerevisiae tridecapeptide pheromone YL Zhang, HUIFEN LU, JM Becker - The Journal of peptide , 1997 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1997.tb01190.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1997.tb01190.x</a> Synthesis, Biological Activity, and Conformational Analysis of Peptidomimetic Analogues of the Saccharomyces cerevisiae alpha-Factor Tridecapeptide YL Zhang, HR Marepalli, H Lu, JM Becker - Biochemistry, 1998 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi980787u" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi980787u</a> Receptor in Saccharomyces cereuisiae SK RathsSQ, M BeckerSII - researchgate.net<a href="https://www.researchgate.net/profile/Jeffrey-Becker-2/publication/20308809_Peptide_analogs_compete_with_binding_of_-factor_to_its_receptor_in_Saccharomyces_cerevisiae/links/09e415111549c85414000000/Peptide-analogs-compete-with-binding-of-factor-to-its-receptor-in-Saccharomyces-cerevisiae.pdf" target="_blank" rel="noreferrer noopener">https://www.researchgate.net/profile/Jeffrey-Becker-2/publication/20308809_Peptide_analogs_compete_with_binding_of_-factor_to_its_receptor_in_Saccharomyces_cerevisiae/links/09e415111549c85414000000/Peptide-analogs-compete-with-binding-of-factor-to-its-receptor-in-Saccharomyces-cerevisiae.pdf</a> Peptide analogues compete with the binding of alpha-factor to its receptor in Saccharomyces cerevisiae. SK Raths, F Naider, JM Becker - Journal of Biological Chemistry, 1988 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0021925819778405" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0021925819778405</a> Binding of fluorinated phenylalanine alpha-factor analogues to ste2p: Evidence for a cation-Ï€ binding interaction between a peptide ligand and its cognate G protein S Tantry, FX Ding, M Dumont , JM Becker, F Naider - Biochemistry, 2010 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi100280f" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi100280f</a> Position 13 analogs of the tridecapeptide mating pheromone from Saccharomyces cerevisiae: design of an iodinatable ligand for receptor binding S Liu, B Arshava, F Naider, LK Henry - Journal of Peptide , 2000 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-3011.2000.00730.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-3011.2000.00730.x</a> Ab initio calculations on Pro-Ala and Pro-Gly dipeptides O Antohi, F Naider, AM Sapse - Journal of Molecular Structure , 1996 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/0166128095043608" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/0166128095043608</a> Structural requirement tryptophan1,3 of tridecapeptide mating pheromone of Saccharomyces cerevisiae NJ Hong, YA Park, JW Lee - : Proceedings of the 1st International Peptide , 2002 - Springer<a href="https://link.springer.com/content/pdf/10.1007/0-306-46864-6_157.pdf" target="_blank" rel="noreferrer noopener">https://link.springer.com/content/pdf/10.1007/0-306-46864-6_157.pdf</a> Studies on conformational consequences of i to i+ 3 side-chain cyclization in model cyclic tetrapeptides MH RAO, WEI YANG, H JOSHUA - Journal of Peptide , 1995 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1995.tb01057.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1995.tb01057.x</a> Specificity characterization of the alpha-mating factor hormone by Kex2 protease MA Manfredi, AA Antunes, LOP Jesus, MA Juliano - Biochimie, 2016 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0300908416302358" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0300908416302358</a> Control of the yeast cell cycle with a photocleavable alpha-factor analogue LL Parker , JW Kurutz, SBH Kent - Chemie (International ed , 2006 - ncbi.nlm.nih.gov<a href="https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2788609/" target="_blank" rel="noreferrer noopener">https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2788609/</a> Matrix-assisted laser desorption/ionization mass spectrometry peptide sequencing utilizing selective N-terminal bromoacetylation J Song, HJ Kim - Analytical biochemistry, 2012 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0003269711007548" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0003269711007548</a> Solution Structures of i to i + 3 Cyclized Model Peptides: Building Blocks Mimicking Specific Conformations HR Marepalli, O Antohi, JM Becker - Journal of the American , 1996 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/ja954217i" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/ja954217i</a> Highly active analogs of alpha-factor and their activities against Saccharomyces cerevisiae HJ Ahn, EY Hong, DH Jin, NJ Hong - Bulletin of the Korean Chemical , 2014 - Citeseer<a href="https://citeseerx.ist.psu.edu/document?repid=rep1&amp;type=pdf&amp;doi=509ee315e2cbcb9fac108f48dfb1fa89d076f1b2" target="_blank" rel="noreferrer noopener">https://citeseerx.ist.psu.edu/document?repid=rep1&amp;type=pdf&amp;doi=509ee315e2cbcb9fac108f48dfb1fa89d076f1b2</a> Identification of residue-to-residue contact between a peptide ligand and its G protein-coupled receptor using periodate-mediated dihydroxyphenylalanine cross GKE Umanah, L Huang , F Ding, B Arshava - Journal of biological , 2010 - ASBMB<a href="https://www.jbc.org/article/S0021-9258(20)60639-1/abstract" target="_blank" rel="noreferrer noopener">https://www.jbc.org/article/S0021-9258(20)60639-1/abstract</a> Cross-linking of a DOPA-containing peptide ligand into its G protein-coupled receptor GKE Umanah, C Son , FX Ding, F Naider - Biochemistry, 2009 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi802061z" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi802061z</a> Structural requirements for alpha-mating factor activity G Houen, O Nielsen, C Flanagan - FEBS letters, 1996 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/0014579396007260" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/0014579396007260</a> The alpha-factor mating pheromone of Saccharomyces cerevisiae: a model for studying the interaction of peptide hormones and G protein-coupled receptors F Naider, JM Becker - Peptides, 2004 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0196978104002943" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0196978104002943</a> Studies on the yeast alpha-mating factor: A model for mammalian peptide hormones F Naider, J Gounarides, CB Xue - Biopolymers , 1992 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1002/bip.360320407" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1002/bip.360320407</a> Probing the Binding Site of a Heptahelical Peptide Pheromone Receptor Using Photoaffinity Labelling, Site-Directed Mutagenesis and Spectroscopic Approaches F Naider, BK Lee, LK Henry, F Ding, SK Khare - Peptides: The Wave of , 2001 - Springer<a href="https://link.springer.com/chapter/10.1007/978-94-010-0464-0_409" target="_blank" rel="noreferrer noopener">https://link.springer.com/chapter/10.1007/978-94-010-0464-0_409</a> Biophysical studies on a transmembrane peptide of the Saccharomyces cerevisiae alpha-factor receptor F Naider, B Arshava, H Xie, S Liu, WY Eng - Peptides for the New , 2002 - Springer<a href="https://link.springer.com/content/pdf/10.1007/0-306-46881-6_151.pdf" target="_blank" rel="noreferrer noopener">https://link.springer.com/content/pdf/10.1007/0-306-46881-6_151.pdf</a> Characterization of novel peptide agonists of the alpha mating factor of Saccharomyces cerevisiae EG Siegel, R Gunther, H Schafer, UR Fölsch - Analytical , 1999 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0003269799942896" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0003269799942896</a> Antagonistic and synergistic peptide analogs of the tridecapeptide mating pheromone of Saccharomyces cerevisiae E Eriotou-Bargiota , CB Xue, F Naider, JM Becker - Biochemistry, 1992 - ACS Publications<a href="https://pubs.acs.org/doi/pdf/10.1021/bi00117a036" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/pdf/10.1021/bi00117a036</a> Probing the functional conformation of the tridecapeptide mating pheromone of Saccharomyces cerevisiae through study of disulfide-constrained analogs CHUB XUE, A MCKINNEY, HUIFEN LU - journal of peptide , 1996 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1996.tb01336.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1996.tb01336.x</a> Spiegel, zyxwvutsrqponm B Molitoris, AC Alfrey, RA Harris, FR Simon - Am. J. Physiol, 1985 - academia.edu<a href="https://www.academia.edu/download/41221846/Antagonistic_and_synergistic_peptide_ana20160115-15517-198v4vt.pdf" target="_blank" rel="noreferrer noopener">https://www.academia.edu/download/41221846/Antagonistic_and_synergistic_peptide_ana20160115-15517-198v4vt.pdf</a> Long-distance rotational echo double resonance measurements for the determination of secondary structure and conformational heterogeneity in peptides B Arshava, M Breslav, O Antohi, RE Stark - Solid State Nuclear , 1999 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0926204099000181" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0926204099000181</a> Synthesis of biologically active analogs of the dodecapeptide alpha-factor mating pheromone of Saccharomyces cerevisiae A EWENSON, S MARCUS - Journal of Peptide , 1990 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1990.tb00944.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1990.tb00944.x</a></p>
  • 4,4,4,4',4',4'-Hexafluoro-DL-valine

    CAS :
    Formule :C5H5F6NO2
    Degré de pureté :>98.0%(T)
    Couleur et forme :White to Almost white powder to crystal
    Masse moléculaire :225.09

    Ref: 3B-H1427

    Produit arrêté
  • H-RINSAKDDAAGLQIA-OH


    <p>Peptide H-RINSAKDDAAGLQIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • H-IYQEPFKNLK-OH


    <p>Peptide H-IYQEPFKNLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH


    <p>H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>
    Formule :C211H318N62O59S3
    Masse moléculaire :4,763.42 g/mol
  • H-ALVEICTEM-OH


    <p>Peptide H-ALVEICTEM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • H-DGRGDS-OH


    <p>Peptide H-DGRGDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • H-WRQAAFVDSY-OH


    <p>Peptide H-WRQAAFVDSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
  • Lugdunin

    CAS :
    <p>Lugdunin is a synthetic antibiotic that has been shown to inhibit the growth of bacteria by binding to the cell membrane. This binding causes a change in membrane potential, leading to inhibition of bacterial growth and death. Lugdunin is effective against Staphylococcus aureus, including methicillin-resistant strains, and has been found to be safe for use in humans. It is also active against other Gram-positive bacteria such as Streptococcus pneumoniae and Enterococcus faecalis. The enantiomer of lugdunin does not have antibacterial activity.</p>
    Formule :C40H62N8O6S
    Degré de pureté :Min. 95%
    Masse moléculaire :783.05 g/mol
  • Iberiotoxin

    CAS :
    <p>Iberiotoxin a synthetic scorpion toxin sourced from the Buthus tamulus scorpion, has disufide bonds formed between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. This prodict can be used as a Ca2+-Activated K+ Channel Blocker (Maxi-K+ Channel Blocker). This peptide can be used in pharmacological studies to investigate the effects of Iveriotoxin on various ion channels and receptors. This product is available as a 0.1mg vial.</p>
    Formule :C179H274N50O55S7
    Degré de pureté :Min. 95%
    Masse moléculaire :4,230.8 g/mol

    Ref: 3D-PIB-4235-S

    Produit arrêté
  • Insulin, human


    <p>Insulin is a peptide hormone that is produced by beta cells in the pancreas. Insulin has several important functions, including regulation of blood sugar levels, lipid metabolism and protein synthesis. It is also involved in the regulation of cellular growth and proliferation. Insulin binds to insulin receptors on the surface of cells, activating them and allowing for the uptake of glucose into cells and storage as glycogen. Insulin is a ligand for the insulin receptor. It can also bind to other receptors, such as IGF1R, which causes activation of PI3K/AKT pathway. Insulin is an antibody that can be used as research tool or cell biology reagent.<br>INSULIN CAN BE USED TO:<br>- Measure blood sugar levels<br>- Monitor diabetes<br>- Treat diabetes<br>- Control weight gain<br>- Improve muscle mass</p>
  • Neutrophil Gelatinase Associated Lipocalin/Lipocalin-2, human, recombinant


    <p>Neutrophil Gelatinase Associated Lipocalin (NGAL) is a lipocalin protein that is involved in many physiological and pathophysiological processes. NGAL binds to bacterial products, such as lipopolysaccharide, and can be used as a biomarker for inflammation or infection. NGAL has been shown to be elevated in the urine of patients with urinary tract infections. Additionally, NGAL has been shown to be associated with neurological diseases, such as Alzheimer's disease and Parkinson's disease. The recombinant human form of this protein can be used for research purposes or for the development of diagnostic tools. Neutrophil Gelatinase Associated Lipocalin (NGAL) is a lipocalin protein that is involved in many physiological and pathophysiological processes. It binds to bacterial products, such as lipopolysaccharide, and can be used as a biomarker for inflammation or infection. NGAL has been shown to be elevated in the urine of patients</p>
    Degré de pureté :Min. 95%
  • CEA, CAP-1-6-D, [Asp6]-Carcinoembryonic Antigen


    <p>Custom research peptide; min purity 95%.</p>
    Formule :C43H68N10O15
    Degré de pureté :Min. 95%
    Masse moléculaire :965.08 g/mol
  • KRAS Blocking Peptide


    <p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRAS antibody, catalog no. 70R-5673</p>
    Degré de pureté :Min. 95%

    Ref: 3D-33R-9058

    Produit arrêté
  • Decorsin


    <p>Decorsin is a research tool that is an activator and ligand for the human receptor. It binds to the receptor by altering its conformation, which leads to cell signaling. Decorsin has been shown to inhibit ion channels, such as potassium channels, and may also function as a receptor antagonist. Decorsin is a high-purity protein with a purity of &gt; 95%. This protein is used in cell biology, pharmacology, and life science research. It can be used as an inhibitor of peptides in the field of protein interactions.</p>
    Formule :C179H271N55O62S6
    Degré de pureté :Min. 95%
    Masse moléculaire :4,377.8 g/mol

    Ref: 3D-PDC-4269-S

    Produit arrêté
  • Angiotensin II (3-8), human


    <p>Custom research peptide; min purity 95%.</p>
    Formule :C40H54N8O8
    Degré de pureté :Min. 95%
    Masse moléculaire :774.93 g/mol
  • Melanocyte Protein PMEL 17 (256-264) (human, bovine, mouse)


    <p>Custom research peptide; min purity 95%.</p>
    Formule :C44H67N9O14
    Degré de pureté :Min. 95%
    Masse moléculaire :946.08 g/mol
  • P2RX2 Blocking Peptide


    <p>A synthetic peptide for use as a blocking control in assays to test for specificity of P2RX2 antibody, catalog no. 70R-5171</p>
    Degré de pureté :Min. 95%
  • H-ASCMGLIY-OH


    <p>Portion of Influenza M</p>
  • H-MEVGWYRPPFSRVVHLYRNGK-OH


    <p>MOG(35-55) human corresponds to amino acids 35 to 55 of the human myelin oligodendrocyte glycoprotein (MOG). It can be used in multiple sclerosis research to induce experimental autoimmune encephalomyelitis (EAE) in mouse and rat models.</p>
  • Big Endothelin-1 (Human, 1-38)

    CAS :
    <p>This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11 and is available as a 0.1mg vial. Big Endothelin-1 (Human, 1-38) is part of the full lengthed 29 amino acid peptide Big Endothlin-1 which is a precursor peptide of the vasoconstrictorEndothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system.<br>Overall Big Endothelin-1 (Human, 1-38) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.</p>
    Formule :C189H282N48O56S5
    Degré de pureté :Min. 95%
    Masse moléculaire :4,282.9 g/mol

    Ref: 3D-PED-4208-S

    Produit arrêté
  • C1ORF131 Blocking Peptide


    <p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf131 antibody, catalog no. 70R-4090</p>
    Degré de pureté :Min. 95%

    Ref: 3D-33R-9091

    Produit arrêté
  • AMC

    CAS :
    <p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END&gt;</p>
    Formule :C10H9NO2
    Degré de pureté :Min. 95%
    Masse moléculaire :175.18 g/mol
  • Peptide YY(3-36), PYY, human


    <p>Custom research peptide; min purity 95%.</p>
    Formule :C180H279N53O54
    Degré de pureté :Min. 95%
    Masse moléculaire :4,049.55 g/mol
  • Neurokinin A (Human, Porcine, Rat, Mouse)


    <p>Neurokinin A is a peptide that is derived from the precursor protein, preprotachykinin A, and has been found to be an endogenous ligand for the NK-1 receptor. It is involved in a wide range of physiological processes such as neurotransmission and regulation of blood pressure. Neurokinin A has been shown to inhibit adenylate cyclase activity in guanethidine-sensitive tissues and ionophores-resistant cells. The effects of Neurokinin A are not due to its ability to bind to the NK-1 receptor but rather through other mechanisms. The amino acid sequence of this peptide was first determined by cloning methods in 1984 and it has since been used extensively as a tool for studying the function of this receptor. Neurokinin A also inhibits cell proliferation in glioma cells and has been shown to have an inhibitory effect on Ca2+ concentration during electrical nerve stimulation.</p>
    Formule :C50H80N14O14S•2CH3COOH•5H2O
    Degré de pureté :Min. 95%
    Masse moléculaire :1,343.48 g/mol

    Ref: 3D-PNK-4154

    Produit arrêté
  • Azido-dPEG®3-Amine

    CAS :
    <p>Azido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>
    Degré de pureté :Min. 95%
    Masse moléculaire :218.25 g/mol
  • SPOPL Blocking Peptide


    <p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPOPL antibody, catalog no. 70R-8870</p>
    Degré de pureté :Min. 95%
  • SYNCRIP Blocking Peptide


    <p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNCRIP antibody, catalog no. 70R-1335</p>
    Degré de pureté :Min. 95%

    Ref: 3D-33R-3941

    Produit arrêté
  • Rituximab Light chain (41-55)


    <p>Rituximab is a chimeric monoclonal antibody used in the treatment of some cancers like CD20 non-Hodgkin's lymphoma and a few autoimmune conditions such as rheumatoid arthritis. However, antibody treatment can lead to generation of neutralising antibodies thus curtailing the efficacy of the therapy. CD 4+ T cells are critical to initiate antibody response so identification of epitopes within molecules using T cell assays can be a vital tool for understanding the immune response and thereby prevent induction of neutralising antibodies. Within rituximab, the variable region of the light chain (41-55) was found to have strong affinity for leukocytes in a specific binding assay, the epitope was also correlated to patients who developed neutralising antibodies. This T cell epitope within rituximab in further immune studies could help design or selection of antibodies without T cell epitopes present for low immunogenicity.</p>
    Masse moléculaire :1,620.8 g/mol
  • H-KKKSPGEYVNIEFG-OH


    <p>Custom research peptide; min purity 95%.</p>
    Degré de pureté :Min. 95%
  • Glucagon (Human, Rat, Mouse)-EIA Kit (1ea)


    <p>The Glucagon (Human, Rat, Mouse)-EIA Kit is a competitive enzyme immunoassay for the quantitative measurement of human glucagon in urine. The kit provides a competitive binding assay format that is designed to measure the concentration of glucagon in urine samples and provides a quantitative result.</p>
    Degré de pureté :Min. 95%

    Ref: 3D-NYK-88090

    Produit arrêté
  • Cysteine


    <p>Cysteine peptide (Ac RFAAKAA COOH) is used in combination with Lysinepeptide (Ac RFAACAA COOH) in the Direct Peptide Reactivity Assay (DPRA) test.<br>Direct Peptide Reactivity Assay is used in cosmetic applications for the characterization of the skin sensitizing potential of a substance, framed by OECD Guideline no 442.<br>The molecular initiating event (MIE) in skin sensitization is a binding between epidermal proteins and the sensitizing chemical substance. MIE is part of the adverse outcome pathway (AOP) of skin sensitization.<br>It is thanks to the properties of Lysine peptide and Cysteine peptide that the chemical binding will be able to take place, so these synthetic heptapeptides will mimic the reaction of a skin exposed to a substance.<br>Binding between nucleophilic proteins and electrophile substance will be measured by High Performance Liquid Chromatography (HPLC). Therefore, the decrease in Lysine peptide and Cysteine peptide levels will be a sign of sensitizing event. Depending on the rate of depletion, the sensitizing character of a molecule will be determined (see table at the bottom of the page).<br>In chemico DPRA test also has wider applications such as hazard classification in cosmetics, but also for pharmaceuticals and biocides. It is a good alternative to animal experimentation.</p>
    Formule :C32H50O9N10S1
    Masse moléculaire :750.87 g/mol
  • Fibromodulin Blocking Peptide


    <p>A synthetic peptide for use as a blocking control in assays to test for specificity of FMOD antibody, catalog no. 70R-5310</p>
    Degré de pureté :Min. 95%

    Ref: 3D-33R-9917

    Produit arrêté
  • Head activator


    <p>Catalogue peptide; min. 95% purity</p>
    Formule :C54H84N12O14
    Masse moléculaire :1,125.36 g/mol
  • Prolactin Releasing Peptide (1-31), bovine


    <p>Catalogue peptide; min. 95% purity</p>
    Formule :C157H244N54O41S
    Masse moléculaire :3,576.01 g/mol
  • Myelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate

    CAS :
    <p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>
    Formule :C118H177N35O29S•C2HO2F3
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :2,695.98 g/mol
  • H-His-Arg-OH

    CAS :
    <p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>
    Formule :C12H21N7O3
    Degré de pureté :Min. 95%
    Masse moléculaire :311.34 g/mol
  • [Ala81]-MBP (74-85)


    <p>Catalogue peptide; min. 95% purity</p>
    Formule :C55H94N20O21
    Masse moléculaire :1,371.48 g/mol
  • CJC-1295

    CAS :
    <p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>
    Degré de pureté :Min. 95%