Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29779 produits trouvés pour "Peptides"
H-ISPRTLNAW-OH
Peptide H-ISPRTLNAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGLKKLGKKLEGAGKRVFNAAEKALPVVAGAKALGK-OH
H-GGLKKLGKKLEGAGKRVFNAAEKALPVVAGAKALGK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormule :C162H284N48O42Masse moléculaire :3,576.33 g/molH-RPQGGSRPEFVKL-OH
H-RPQGGSRPEFVKL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-RRRRWRERQRQIRSI-OH
Peptide H-RRRRWRERQRQIRSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FRKAQIQGL-OH
Peptide H-FRKAQIQGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSAQQVQGVHAR-OH
Peptide H-VSAQQVQGVHAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GYEVHHQK-NH2
Peptide H-GYEVHHQK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AF647-FLPLLILGSLLMTPPVIQAIHDAQR-NH2
H-AF647-FLPLLILGSLLMTPPVIQAIHDAQR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-LEETVQAK-OH
Peptide H-LEETVQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ANELLINVK-OH
Peptide H-ANELLINVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QIVQNLR-OH
Peptide H-QIVQNLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIEVQGFR-OH
Peptide H-DIEVQGFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EGYLQIGANTQAAQK-OH
Peptide H-EGYLQIGANTQAAQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LFDNAMLR-OH
Peptide H-LFDNAMLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRYCKSTEL-OH
Peptide H-RRYCKSTEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QEEDEDEDEER-OH
Peptide H-QEEDEDEDEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GEPLARLELFVVLTRLLQ-NH2
Peptide H-GEPLARLELFVVLTRLLQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVEIGSFLLGR-OH
Peptide H-AVEIGSFLLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.EGF Receptor Substrate 2
Peptide EGF Receptor Substrate 2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formule :C54H82N13O24PMasse moléculaire :1,328.32 g/molH-FHL-OH
Peptide H-FHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LVNELTEFAK-OH
Peptide H-LVNELTEFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVPI-OH
Peptide H-AVPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FYAEATPML-OH
Peptide H-FYAEATPML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CGKRK-OH
Peptide H-CGKRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WVYHTQGYFPDWQNY-OH
Peptide H-WVYHTQGYFPDWQNY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVDALGNAIDGK-OH
Peptide H-VVDALGNAIDGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRLTARGLL-OH
Peptide H-RRLTARGLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILHNGAYSL-OH
Peptide H-ILHNGAYSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALNSEALSV-OH
Peptide H-ALNSEALSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CDITQVMSKLDRRSQL-OH
Peptide H-CDITQVMSKLDRRSQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PLKAEIAQRLEDV-OH
Peptide H-PLKAEIAQRLEDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LRAIEAQQHM-OH
Peptide H-LRAIEAQQHM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LQQCPF-OH
Peptide H-LQQCPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QSFQISNYVGRKSSD-OH
Peptide H-QSFQISNYVGRKSSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KPLLIIAEDVEGE-OH
Peptide H-KPLLIIAEDVEGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALQQIMENQSDRLQG-OH
Peptide H-ALQQIMENQSDRLQG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DYKDDDDKC-OH
Peptide H-DYKDDDDKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHGLEIEGR-OH
Peptide H-VHGLEIEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLTDYLMK-OH
Peptide H-DLTDYLMK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ATLTVDK-OH
Peptide H-ATLTVDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CRRRRRRRRR-OH
Peptide H-CRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STMMSRSHKTRSHHV-OH
Peptide H-STMMSRSHKTRSHHV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TLVVHEK-OH
Peptide H-TLVVHEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EQELLELDKWASLWN-OH
Peptide H-EQELLELDKWASLWN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLDSVLQQLQTEVYR-OH
Peptide H-HLDSVLQQLQTEVYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Nesfatin-1 (rat) trifluoroacetate salt
CAS :Please enquire for more information about Nesfatin-1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C424H684N116O136Degré de pureté :Min. 95%Masse moléculaire :9,582.67 g/molH-GAFFLYDRL-OH
Peptide H-GAFFLYDRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NYNYLYRLF-OH
Peptide H-NYNYLYRLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HEIPVLPNR-OH
Peptide H-HEIPVLPNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PPEAPAEDRSL-OH
Peptide H-PPEAPAEDRSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GYGFGLIK-OH
Peptide H-GYGFGLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YIQDIVASTLK-OH
Peptide H-YIQDIVASTLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DSGLCMPRLRGCDPR-OH
Peptide H-DSGLCMPRLRGCDPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FVFGTTPEDILR-OH
Peptide H-FVFGTTPEDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ISHNFCNL-OH
Peptide H-ISHNFCNL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IIAPPERK-OH
Peptide H-IIAPPERK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LASGVPSR-OH
Peptide H-LASGVPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VEEVSLRK-OH
Peptide H-VEEVSLRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SSPAVEQQLLVSGPGK-OH
Peptide H-SSPAVEQQLLVSGPGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FNAVLTNPQGDYDTSTGK-OH
Peptide H-FNAVLTNPQGDYDTSTGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DFD-OH
Peptide H-DFD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CGKPIPNPLLGLDST-OH
Peptide H-CGKPIPNPLLGLDST-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KYLQVASHVGL-OH
Peptide H-KYLQVASHVGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FALNAANAR-OH
Peptide H-FALNAANAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IPRRIRQGF-OH
Peptide H-IPRRIRQGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HLA leader peptide LLL (8mer)
Fragment of the signal peptide from endogenous HLA Class I molecules which is also found in viral glycoproteins, for example human Cytomegalovirus (hCMV) protein UL40. When presented on a cell surface via HLA-E molecules, the HLA- VMAPRTLLL complex binds NKG2A receptors on Natural Killer (NK) cells and some CD8⁺ cytotoxic T cells to reduce their cytotoxic activity. Blocking this interaction is an attractive opportunity for immune checkpoint (IC) approach therapies. This is relevant in both cancer therapies, and viral infections, where endogenous HLA Class I peptide presentation is exploited to escape immune attack. In one study, VMAPRTLLL UL4015-23 was found in 10% congenital cytomegalovirus (cCMV) strains.Peptide H-VMAPRTLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FDEQLPIK-OH
Peptide H-FDEQLPIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGAMSPMSWNSDASTSEAS-OH
Peptide H-SGAMSPMSWNSDASTSEAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LFAYPDTHR-OH
Peptide H-LFAYPDTHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH
Peptide H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDSPDRPWNPPTFSPALL-OH
Peptide H-LDSPDRPWNPPTFSPALL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CTASLPQEDMEPNATPTTPEA-OH
Peptide H-CTASLPQEDMEPNATPTTPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DDDDK-OH
Peptide H-DDDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AETSELHTSLK-OH
Peptide H-AETSELHTSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLALWGPDPAAAFVN-OH
Peptide H-LLALWGPDPAAAFVN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Chloromethyl Polystyrene Resin cross-linked with 1% DVB (200-400mesh) (0.8-1.3mmol/g)
CAS :Couleur et forme :SolidH-VRSYCYEASISDMAS-OH
Peptide H-VRSYCYEASISDMAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSSPAVITDK-OH
Peptide H-LSSPAVITDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDTGETGVTGVEGPR-OH
Peptide H-GDTGETGVTGVEGPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VDWENVSPEL-OH
Peptide H-VDWENVSPEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NWAPGEPNNR-OH
Peptide H-NWAPGEPNNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VWLSAIWM-OH
Peptide H-VWLSAIWM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AAVYHHFISDGVR-OH
Peptide H-AAVYHHFISDGVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKRNRTLTV-OH
Peptide H-KKRNRTLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MGLKFRQL-OH
Peptide H-MGLKFRQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RVYIHP-OH
Peptide H-RVYIHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLAFLPESFD-OH
Peptide H-SLAFLPESFD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPEVIPMFSALSEGA-OH
Peptide H-SPEVIPMFSALSEGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ATVVYQGER-OH
Peptide H-ATVVYQGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RYLPSD-OH
Peptide H-RYLPSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KYTYDELFQLK-OH
Peptide H-KYTYDELFQLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RRRRPRRVSRRRRRRGGRRRR-OH
Peptide H-RRRRPRRVSRRRRRRGGRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYPGLTSYLVR-OH
Peptide H-SYPGLTSYLVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GIVE-OH
Peptide H-GIVE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FYFENLLAK-OH
Peptide H-FYFENLLAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AEGEFCSWAPPKASCGDPAK-OH
Peptide H-AEGEFCSWAPPKASCGDPAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PIIHFGSDYEDR-OH
Peptide H-PIIHFGSDYEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SFEDIHHYREQIK-OH
Peptide H-SFEDIHHYREQIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GGAGHVPEYFVGIGTPISFYG-OH
Peptide H-GGAGHVPEYFVGIGTPISFYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVGIGALFLGFLGAAGSTMGARS-OH
Peptide H-AVGIGALFLGFLGAAGSTMGARS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DSSTSPGDYVLSVSENSR-OH
Peptide H-DSSTSPGDYVLSVSENSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IAQSDYIPTQQDVLR-OH
Peptide H-IAQSDYIPTQQDVLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FPRGQGVPI-OH
Peptide H-FPRGQGVPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ISQAVHAAHAEINEA-OH
Peptide H-ISQAVHAAHAEINEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLDLLEGLTGQK-OH
Peptide H-LLDLLEGLTGQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VDPVNFK-OH
Peptide H-VDPVNFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AFLTVKKQM-OH
Peptide H-AFLTVKKQM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSFLIPAGWVLSHLDHYKRSSAA-OH
Peptide H-LSFLIPAGWVLSHLDHYKRSSAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SATPE-OH
Peptide H-SATPE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FRKQNPDIVIYQYMDDLYVG-OH
Peptide H-FRKQNPDIVIYQYMDDLYVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IQNILTEEPK-OH
Peptide H-IQNILTEEPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.hBID peptide
BH3 interacting-domain death agonist (BID) is a pro-apoptotic member of the Bcl-2 protein family. BID is a BH3-only protein that connects the extrinsic TNFR1 and Fas death signaling pathway to the mitochondrial amplification cascade of the intrinsic death pathway. BID is believed to activate multidomain pro-apoptotic proteins BAX or BAK directly. hBID peptide is a 21 amino acid amide from the human protein BID. BID is BH3-interacting domain death agonist. This hBID peptide encompasses the BH3 motif containing the conserved LXXXXD, which is required for BID for pro-apoptotic activity and to interact with anti-apoptotic members of the Bcl-2 family. It is a useful reagent for BH3 profiling,H-VYDFFVWL-OH
Peptide H-VYDFFVWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CQGQPERDEKIKEPT-OH Acetate salt
Please enquire for more information about H-CQGQPERDEKIKEPT-OH Acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageH-KLVELEHTL-OH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-VFAQ-OH
Peptide H-VFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RPAIAINNPYVPR-OH
Peptide H-RPAIAINNPYVPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YSFTIELR-OH
Peptide H-YSFTIELR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EAQNTTYL-OH
Peptide H-EAQNTTYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WERPFEVK-OH
Peptide H-WERPFEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EAFQEALAAAGDK-OH
Peptide H-EAFQEALAAAGDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Epitope1- I80-N92-B
90%; Research Peptide matching Epitope1- I80-N92-BFormule :C77H131N23O22S2Couleur et forme :PowderMasse moléculaire :1,813.15 g/molH-EQVTNVGGAVVTGVTAVAQK-OH
Peptide H-EQVTNVGGAVVTGVTAVAQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YPNVNIHNF-OH
Peptide H-YPNVNIHNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGGGRGDY-OH
Peptide H-GGGGRGDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IYHSHIDAPK-OH
Peptide H-IYHSHIDAPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASVSVTAEDEGTQR-OH
Peptide H-ASVSVTAEDEGTQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IAEYMNHLIDIGVAGFR-OH
Peptide H-IAEYMNHLIDIGVAGFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELVYETVR-OH
Peptide H-ELVYETVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FIDKFTPPV-OH
Peptide H-FIDKFTPPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IQASFR-OH
Peptide H-IQASFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVGACGVGK-OH
Peptide H-VVGACGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALQDQLVLVAAK-OH
Peptide H-ALQDQLVLVAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LTGMAFR-OH
Peptide H-LTGMAFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QDVDNASLAR-OH
Peptide H-QDVDNASLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPSIFPLAPSSK-OH
Peptide H-GPSIFPLAPSSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DREQAPNLVY-OH
Peptide H-DREQAPNLVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLHDSPLTPGQGGGYGRKKRRQRRR-OH
Peptide H-SLHDSPLTPGQGGGYGRKKRRQRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLADLDNSL-OH
Peptide H-GLADLDNSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILMWEAVTL-OH
Peptide H-ILMWEAVTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AHHPIWARMDA-OH
Peptide H-AHHPIWARMDA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVSEIQLMHNLGK-OH
Peptide H-SVSEIQLMHNLGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-rytvela-OH
Peptide H-rytvela-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FAHTVVTSR-OH
Peptide H-FAHTVVTSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVQREKRAVGIGAMF-OH
Peptide H-VVQREKRAVGIGAMF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YIPEITLPV-OH
Peptide H-YIPEITLPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QIKVRVDMV-OH
Peptide H-QIKVRVDMV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GVKFRGSTGGKAPRGKAPATSGMVGPHR-OH
Peptide H-GVKFRGSTGGKAPRGKAPATSGMVGPHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLNYGVCVC-OH
Peptide H-VLNYGVCVC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CTASNKNRGIIKTFS-OH
Peptide H-CTASNKNRGIIKTFS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YKVVKIEPL-OH
Peptide H-YKVVKIEPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SQLTKPISSLTKPYH-OH
Peptide H-SQLTKPISSLTKPYH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WMHHNMDLI-OH
Peptide H-WMHHNMDLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LIYDSSLCDL-OH
Peptide H-LIYDSSLCDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGYVSGWGR-OH
Peptide H-VGYVSGWGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NSPRRARSV-OH
Peptide H-NSPRRARSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VEWLR-OH
Peptide H-VEWLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGGHAAEYGAEALER-OH
Peptide H-VGGHAAEYGAEALER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLLTVLTVV-OH
Peptide H-LLLTVLTVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RIAECILGV-OH
Peptide H-RIAECILGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVMSWAPPV-OH
Peptide H-VVMSWAPPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DPLNVLKPR-OH
Peptide H-DPLNVLKPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CGRGDS-OH
Peptide H-CGRGDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TRVLAMAIY-OH
Peptide H-TRVLAMAIY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVVTVIDVFYK-OH
Peptide H-SVVTVIDVFYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KIRLRPGGKK-OH
Peptide H-KIRLRPGGKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVGSPSAQDEASPL-OH
Peptide H-VVGSPSAQDEASPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.KRAS (5-14) WT
Peptide H-KLVVVGAGGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALNSIIDVYHK-OH
Peptide H-ALNSIIDVYHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WKFDSRLAF-OH
Peptide H-WKFDSRLAF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTYCDL-OH
Peptide H-LTYCDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YAWNRKRISNCVADY-OH
Peptide H-YAWNRKRISNCVADY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YSFLQFDPAPR-OH
Peptide H-YSFLQFDPAPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DATNVGDEGGFAPNILENK-OH
Peptide H-DATNVGDEGGFAPNILENK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DDDDDDD-OH
Peptide H-DDDDDDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VDFTLSSER-OH
Peptide H-VDFTLSSER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QGQ-OH
Peptide H-QGQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LFEELVR-OH
Peptide H-LFEELVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YPIEHGIVTNWDDMEK-OH
Peptide H-YPIEHGIVTNWDDMEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTTHPLAK-OH
Peptide H-VTTHPLAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RLLGTEFQV-OH
Peptide H-RLLGTEFQV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIG-OH
Peptide H-DIG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DYWSTVK-OH
Peptide H-DYWSTVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KYNKANVFL-OH
Peptide H-KYNKANVFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLLMVLMLA-OH
Peptide H-KLLMVLMLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LISVDTEHSNIYLQNGPDR-OH
Peptide H-LISVDTEHSNIYLQNGPDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLLPEYGGTK-OH
Peptide H-VLLPEYGGTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLDHWLGAPAPYPDPLEPK-OH
Peptide H-YLDHWLGAPAPYPDPLEPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EPPLSQEAFADLWKK-OH
Peptide H-EPPLSQEAFADLWKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Masse moléculaire :1,759 g/molH-CRGTELDCGIETD-OH
Peptide H-CRGTELDCGIETD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MPFATPMEA-OH
Peptide H-MPFATPMEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MSNLSKGTGSRK-OH
Peptide H-MSNLSKGTGSRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGTQFTR-OH
Peptide H-VGTQFTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGVENPGGYCL-OH
Peptide H-SGVENPGGYCL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELQDLALQGAK-OH
Peptide H-ELQDLALQGAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FDNPVLPFNDGVYFASTEK-OH
Peptide H-FDNPVLPFNDGVYFASTEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTYTGAIKL-OH
Peptide H-LTYTGAIKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLRLIHYSY-OH
Peptide H-GLRLIHYSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EEGGEEGKRNRVTLADLC-OH
Peptide H-EEGGEEGKRNRVTLADLC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AEEGDLLVNPDQPR-OH
Peptide H-AEEGDLLVNPDQPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
