Peptides

<p>Fmoc-Asp(OtBu)-Rink-Amide MBHA Resin is a building block for peptides. It is an acid labile resin that can be cleaved with TFA to provide amine-protected dipeptides and tripeptides. This product is used as a building block for peptide synthesis.</p>

<p>Abz-Ser-Pro-Tyr(NO2)-OH is a peptide that has been shown to be an angiotensin I converting enzyme II (ACE) substrate and an inhibitor of ACE. It also inhibits the release of renin from the juxtaglomerular apparatus, which is needed for the production of angiotensin II. This peptide is used in biochemical research and as a standard for measuring enzymatic activity.</p>

<p>Purotoxin-1 is a peptide that belongs to the group of activators. It is an inhibitor of potassium channels which are involved in the regulation of excitability and repolarization of cells. Purotoxin-1 has been shown to block the binding of calcium ions to the N-type voltage-gated calcium channels, leading to decreased intracellular calcium levels and reduced neurotransmitter release. Purotoxin-1 has been shown to inhibit tumor growth in vivo, which may be due to its ability to inhibit protein interactions with cell surface receptors.</p>

<p>β-Ala-Lys(AMCA) is a peptide that can inhibit the interactions of proteins. β-Ala-Lys(AMCA) is an inhibitor of protein interactions and can be used as a research tool to study the interactions between proteins. β-Ala-Lys(AMCA) has been shown to activate certain receptors, such as the receptor for angiotensin II, and can be used to increase or decrease the activity of ligands. This drug also has a high purity level, which makes it suitable for use in life science research.</p>

<p>Please enquire for more information about Thymosin β10 trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

H-Trp-Lys-Tyr-Met-Val-Met-NH2 is a natural compound that belongs to the group of pharmacological agents. It has been shown to have a therapeutic effect on congestive heart failure, bowel disease and autoimmune diseases. This compound has also been shown to stimulate locomotor activity in mice by increasing dopamine levels in the brain. H-Trp-Lys-Tyr-Met-Val-Met NH2 has been found to inhibit the growth of HL60 cells in culture, which are a type of white blood cell that is involved in immune response. H-Trp-Lys Tyr Met Val Met NH2 also binds to receptors for formyl and sesquiterpenoid lactones, which are chemical compounds that are used as pharmacological agents for cancer therapy and treatment of inflammatory bowel disease.

<p>H-Pro-Val-OH is an amide that is used to treat renal disorders by inhibiting leukocyte elastase. It has been shown to be a potent inhibitor of serine proteases, including chymotrypsin and trypsin. H-Pro-Val-OH binds to the active site on serine proteases and blocks the release of peptides from the enzyme. The binding constant for H-Pro-Val-OH with chymotrypsin was found to be in the range of 3 x 10 M, which is significantly higher than that for other amides. In addition, H-Pro-Val-OH inhibits cytolysis by lysosomal enzymes and protects against liver injury caused by chronic liver disease. This drug also shows low molecular weight and high water solubility, making it effective in treating acute hepatitis.</p>

<p>Please enquire for more information about rec IL-4 (murine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about rec GM-CSF (murine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ile-Asn-OH is a chloroplastic amide that is used as a substrate in polymerase chain reactions. It can be used to study the structure of proteins and enzymes by the use of monoclonal antibodies. H-Ile-Asn-OH has been sequenced and assayed, and found to have high binding affinity for carboxylate groups. This chemical has been shown to have multidomain structures as well as an isotype that is specific for triticum aestivum. H-Ile-Asn-OH may also be involved in plant physiology due to its role in photosynthesis.</p>

<p>H-D-Tyr-Val-NH2 is a regulatory group that acts as the prosthetic group for a number of peptidyl and peptide hormones. H-D-Tyr-Val-NH2 is also involved in catalytic mechanism, as it is the amino acid responsible for the formation of peptide bonds in proteins. H-D-Tyr-Val-NH2 is found in high concentrations in the cerebriform tissue and has been shown to be important for the biosynthesis of amides, which are prohormones. H-D-Tyr-Val NH2 also participates in a number of cellular reactions, including those that have a kinetic rate.</p>

<p>H-STQAAIDQINGK^-OHH-STQAAIDQISGK^-OHH-SDAPIGK^-OHH-DEALNNR^-OHH-EFSEVEGR^-OHH-TITNDR^-OHR^ = Arginine (U-13C6,15N4)K^ = Lysine (U-13C6,15N2)Peptide purity: &gt;98%AAA: Concentration – Duplicate100 aliquots/pack total to equal 1nmol/peptide/vial dry aliquots</p>

<p>Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-SDGPVKV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-MYNPTNILDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Influenza B native 5-peptide mixture of:<br>H-SHFANLK-OHH-SYFANLK-OHH-GVLLPQK-OHH-NLNSLSELEVK-OHH-GILLPQK-OHAAA: Concentration - Duplicate<br>100 aliquots/pack total to equal 1nmol/peptide/vial dry aliquots</p>

<p>H-VNSVIEK^-OHH-EQLSSVSSFER^-OHH-TLDYHDSNVK^-OHH-ITFEATGNLVAPR^-OHR^ = Arginine (U-13C6,15N4)K^ = Lysine (U-13C6,15N2)Peptide purity: &gt;98%AAA: Concentration - Duplicate100 aliquots/pack total to equal 1nmol/peptide/vial dry aliquots</p>

Peptide H-R^PPGFSP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-AIHELIQVMAELSPAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Fluor-VPMLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IQPTTPSEPTAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-PEK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TVAAPSVFIFPPSDEQL^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Dnp-FAQSIPK-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Octreotide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-FVEEIIEETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-FLPLIGRVLSGIL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LGHPDTLNQGEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ADLSGITGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide Ac-FHDDSDEDLLHI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RLVDDFLLV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Cy5-TFSDLWKLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide ÎŽ-MSH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LSALTPSPSWLKYKAL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-FFVPPFQQSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-QFYDQALQQAVVDDDANNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LNILNNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-AYPDANLLNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-GYLPEPVTVTWNSGTLTNGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DLPAPITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-QVQLVESGGGVVQPGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MHRQETVDCLKKFN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FAVFGLGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-NFLINETAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.