Peptides

<p>Peptide H-ALP^AP^IEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-γ-Abu-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin used as a building block in peptide synthesis. The resin is composed of N-(2-chloroethyl)-N,N'-bis(2,3,5,6-tetrafluorohexyl)trimethoxysilane. Resins are inert and insoluble in organic solvents. They are very useful in peptide synthesis because they can be used to link amino acids together by forming amide bonds.</p>

<p>Peptide LCBiot-AAKIQASFRGHMARKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Z-His-Glu-Lys-AMC is an activator of ion channels. It is a ligand that binds to the receptor and stimulates the opening of ion channels in cells. Z-His-Glu-Lys-AMC has been used as a research tool to study protein interactions, pharmacology, and cell biology. It has also been used to study ion channel function and its role in diseases such as epilepsy or schizophrenia.</p>

Peptide H-GFFADYEIPNLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-LNDTTLQVLNTWYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SLGPALLLLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LSYTQQMEDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>A peptide derived from the Hrk (Harakiri) protein, which is a pro-apoptotic member of the BH3-only family within the larger Bcl-2 family of proteins. The BH3 domain of Hrk, contained in the Hrk BH3 peptide, is the critical region responsible for promoting apoptosis by interacting with and neutralizing anti-apoptotic proteins like Bcl-2, Bcl-xL, and Mcl-1.The BH3 domain within the Hrk BH3 peptide binds to anti-apoptotic proteins, disrupting their ability to prevent apoptosis. This releases pro-apoptotic proteins like Bax and Bak, allowing them to oligomerize and permeabilize the mitochondrial outer membrane. This leads to the release of cytochrome c and the activation of downstream caspases, which execute cell death.Hrk specifically targets Bcl-xL and Mcl-1 more efficiently than some other BH3-only proteins, making it a potent inducer of apoptosis in cells where these anti-apoptotic proteins are overexpressed, such as in certain cancer cells.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-SSIMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-R^PHFPQFSYSASGTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-NQNTFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Cyc-RGGLCYCRGRFCVCVGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of SULT1B1 antibody, catalog no. 70R-2607

<p>Peptide LCBiot-HVPGGGSVQIVYKPVDLSKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ALDAAYCFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A14 antibody, catalog no. 70R-6568

Peptide H-LPDATPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-CNTATCATQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about Biotinyl-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Peptide H-NLHQPPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DRV^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-ADVTPADFSEWSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-NGFFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-LANDAAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-V^T^SGSTSTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

H-Ile-2-ClTrt-Resin (200-400 mesh) 1% DVB is a resin for the synthesis of peptides. The resin is composed of the building blocks Ile, 2-chlorotrityl chloride and N,N'-Dibenzyloxycarbonyl (DBOC). It is used in the manufacture of peptides with amines, alcohols and thiols. This resin can be used in automated peptide synthesizers to produce peptides up to 400 amino acids long.

<p>Peptide H-NYTAPGGGQFTLPGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-LITVQVVPVAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Substance P (SP) is a peptide that is highly conserved across the animal kingdom and is involved in a number of inflammatory and growth promoting processes. SP has a net positive charge at physiological pH, it is an amphiphilic peptide with positively charged residues at the N-terminus and hydrophobic residues at the C-terminus, this controls how it interacts with cell membranes. SP is stable in plasma (several hours) but has a short half-life in tissues (seconds/minutes).SP is encoded by the TAC1 gene and is a member of the tachykinin peptide hormone family. SP is expressed by many cell types including: neurons, astrocytes, microglia, epithelial cells, endothelial cells, immune cells such as T cells and macrophages- dendritic cells and eosinophils and some stem cells and progenitor cells. The huge variety of cell types expressing SP suggest it is involved in a wide variety of physiological and pathophysiological functions.SP mediates its functions by interacting with members of the neurokinin (NK) family of G protein-coupled receptors with high selectivity. Among these, SP binds to NK1R with the highest affinity, this receptor is expressed in a wide range of tissue types.Biotin (B7) has been added to the N-terminus.</p>

Peptide H-LIAPVAEEEATVPNNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-VVVGAGDVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NNLEAL^EDFEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-GIL^GFVF^TL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-SLKLMATLFSTYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide LCBiot-NVKSKIGSTENLKHQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-LANFLVHSSNNFGAILSSTNV^GSNTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GLDKDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-YDNSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-AVYFYAPQIPLYANK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide ttpa-SGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ADDGRPFPQVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-DIVGAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-LRLRGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>