Peptides

<p>Peptide LCBiot-DWEYS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-A^LPAPIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VTSPNITVTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-CSSNTPPLTCQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Peptide H-ASFHIPQVQVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-EAIYAAPFAKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-DPGSAAPYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FRHDS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-YAFGYPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-GTFIIDPGGVIR^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LSITGTYDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SGTLGHPGSLDETTYER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FTFSLDTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-EQDLLSHEQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-VPEPCHPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Latent TGF-β is a non-lysosomal glycoprotein with mannose 6-phosphate (Man-6-P) residues on its N-glycans. When it is released, latent TGF-β is bound to its latency-associated peptide (LAP), it must then be activated and released from LAP before it can bind to its cell surface-localised Man-6-P receptors and exert its biological activity. Activation can occur by various mechanisms in vivo, including those governed by integrins and thrombospondin. Mannose phosphorylation has also been implicated in this activation process. Man-6-P has been proposed as an anti-scarring therapy due to its ability to directly block the activation of latent TGF-β.</p>

<p>Peptide H-SHFANLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-NNNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Des-n-Octanoyl-[Ser3]-Ghrelin (Human, 1-14) is a non-Acylated Analog of Ghrelin (Human, 1-14), amino acids 1-14 of the peptide hormone Ghrelin. This peptide does not contain the unique N-octanoyl group which is linked to Ghrelin's third serine residue covalently and which allows Ghrelin to associate with the growth hormone secretagogue receptor (GHS-R). Through interaction with the GHS-R, Ghrelin can exert its various effects on the body such as stimulating appetite, nutrient sensing, meal initiation and the regulation of insulin resistance, diabetes and obesity. Its wider functions are also associated with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.

<p>Peptide H-GPRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Fibrinopeptide B is a peptidic, biologically active peptide with the sequence Glu-Lys-Arg-Val. It is an epitope of the fibrinogen protein and has been reported to be involved in various biological processes such as cell proliferation, inflammation, and coagulation. Fibrinopeptide B is also a mass spectrometry standard for calibrating mass spectrometers. Biochemicals such as peptides and proteins can be identified by using this peptide. Fibrinopeptide B may also play a role in cancer metastasis and atherosclerosis.

<p>Peptide H-GQPLSP^EK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-FSLTTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-SV^EGSCGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VSQYIEWLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FLPSDFFPSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fmoc-Cys(Xan)-Wang Resin (100-200 mesh) 1% DVB is a research tool used in the synthesis of peptides. It is an inhibitor that blocks the activity of the protein tyrosine phosphatase, which plays a role in the regulation of cell proliferation and differentiation. This resin can be used to produce peptides with cysteine residues that are important for binding to receptors or ion channels. Fmoc-Cys(Xan)-Wang Resin (100-200 mesh) 1% DVB can also be used as a ligand to activate receptors or ion channels. The resin has a purity of 99% and contains less than 0.1% water, so it is suitable for use in research on proteins and cells.</p>

<p>The resin is used for the synthesis of peptides and other small molecules. The resin is a polystyrene-divinylbenzene copolymer that is functionalized with an amino acid sequence. It can be used in automated peptide synthesizers to perform solid phase peptide synthesis.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Fmoc-ACC-Resin is a resin for the synthesis of peptides that has been used for the synthesis of Fmoc-protected amino acids and peptides. The resin is a solid support that can be used in automated peptide synthesizers. It can be used in the synthesis of peptides with N-terminal amine or carboxylic acid groups, such as Fmoc-amino acids, Fmoc-NHS esters, and side chain protected amino acids.

Peptide H-YFIDFVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Cyclo(Arg-Gly-Glu-D-Phe-Lys) is a cyclic peptide that has been used as an inhibitor of the signaling pathway in cells. Cyclo(Arg-Gly-Glu-D-Phe-Lys) binds to the receptor, which may be associated with an ion channel and the activation of a G protein. This peptide can act as a competitive inhibitor of other ligands for this receptor. Cyclo(Arg-Gly-Glu-D-Phe-Lys) is also known to be an activator for some receptors, including the angiotensin II type 1 receptor (AT1). This peptide has been used as a research tool to study receptor function and cellular signaling pathways. It is also being investigated for use in antibody production.

<p>Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MYNPTNILDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LVLPEYGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Consisting of the disulfide Bonds: Cys6- Cys22, Cys9-Cys12, Cys10- Cys18, and Cys13-Cys21 and of the trifluoroacetate salt form, this product can be used as an internal standard for Hepcidin assays.Hepcidin-24 is a peptide hormone that plays a key role in the regulation of iron metabolism in the body. It is produced by the liver and is secreted into the bloodstream, where it interacts with cells in the intestine and other tissues to control the absorption and distribution of iron. Hepcidin acts as a negative regulator of iron uptake and release by binding to and inhibiting the activity of ferroportin, a protein that facilitates the export of iron from cells into the bloodstream. When hepcidin levels are high, ferroportin activity is reduced, leading to decreased iron absorption from the diet and reduced iron release from cells. When hepcidin-24 levels are low, ferroportin activity is increased, leading to increased iron absorption and release. Imbalances in hepcidin levels can lead to a variety of disorders, including iron-deficiency anemia, hemochromatosis (an iron overload disorder), and anemia of chronic disease. Therefore, hepcidin-24 is a key target for the development of treatments for these and other iron-related disorders. In addition to its role in iron metabolism, hepcidin has been shown to have antimicrobial properties, as it can inhibit the growth of certain bacteria and fungi. It may also be involved in the regulation of immune function and inflammation.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-RF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-TAFDEAIAELDTLSEESYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide 5Fam-LPYEGSLLLKLLRAPVEEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>The peptide R5 is made up of 19 amino acids and it precipitates SiO2 nanostruture silica, using its RRIL motif. It is one of the repetitive peptide sequences forming the protein silaffin sillp in Cylindrotheca fusiformis, a marine diatom.</p>

<p>H-Met-Gly-Pro-AMC·HCl is a complex organic compound. It is often used as a reagent in organic synthesis, as well as being a useful intermediate for the production of other fine chemicals. H-Met-Gly-Pro-AMC·HCl is useful for producing speciality chemicals and research chemicals, and can be used as a versatile building block.</p>

<p>Alpha-Mating Factor acetate salt is a complex compound that is a useful intermediate, building block, and reaction component. Alpha-Mating Factor acetate salt has been shown to be a useful scaffold for the synthesis of other compounds. It can also be used as a reagent in research or as a speciality chemical. Alpha-Mating Factor acetate salt is soluble in water and most organic solvents, making it versatile in its applications.</p>

<p>H-Arg-Leu-Leu-Phe-Thr-NH2 is a peptide that has been shown to inhibit the proliferation of cancer cells by interfering with the calcium signaling pathway. It also inhibits the production of pro-inflammatory cytokines and growth factors, which are important in inflammatory diseases. This peptide can be used as a therapeutic agent for ganglia disease, such as human immunodeficiency virus (HIV) infection or diabetes. H-Arg-Leu-Leu-Phe-Thr-NH2 has an inhibitory effect on nociceptors, which are nerve cells that transmit pain signals to the brain. It may also potentiate the effects of other drugs used to treat inflammation.</p>

<p>Peptide H-QLLLSAALSAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

H-Tyr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block that is used in peptide synthesis. It is a thiol-reactive resin with a pendant amine group. H-Tyr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is soluble in common organic solvents and can be used for the synthesis of peptides with amino acids containing aromatic rings.