Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30318 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Ac-SVFAQ-OH
Peptide Ac-SVFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IALGGLLFPASNL^R^-OH
Peptide H-IALGGLLFPASNL^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTGMAFR^-OH
Peptide H-LTGMAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TMGFTAPRFPHY-NH2
Peptide H-TMGFTAPRFPHY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SKIGSTENLK^-OH
Peptide H-SKIGSTENLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGEVNTYAGDLQK^-OH
<p>Peptide H-LGEVNTYAGDLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Ser(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
<p>H-Ser(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin that is designed for the synthesis of peptides. It can be used as a building block and has been shown to react with thiols, alcohols, amines, and other building blocks.</p>Degré de pureté :Min. 95%Ile-Val-Tyr-Arg-Asp-Gly-Asn-Pro-Tyr-Ala
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C53H78N14O16Masse moléculaire :1,167.27 g/molAbz-QPMAVVQSVPQ-EDDnp
<p>Peptide Abz-QPMAVVQSVPQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTHFPICIFCCGCCHR^SK^CGMCCK^T-OH
Peptide H-DTHFPICIFCCGCCHR^SK^CGMCCK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H2N-Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Ty
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C111H156N24O28Masse moléculaire :2,274.57 g/molH-VVLHPNYSQVDIGL^IK-OH
<p>Peptide H-VVLHPNYSQVDIGL^IK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DFLAGGIAAAISK^-OH
<p>Peptide H-DFLAGGIAAAISK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cyclo(-D-Leu-D-Pro)
CAS :<p>Cyclo(-D-Leu-D-Pro) is a macrolide that inhibits the growth of bacteria. It binds to the 50S ribosomal subunit and prevents the formation of an antibiotic-inhibitor complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. Cyclo(-D-Leu-D-Pro) has been shown to have antibacterial activity against the Gram negative bacterium Vibrio anguillarum. This drug has also been shown to have endophytic properties, as it was isolated from an endophytic fungus found in leaves of Eucalyptus trees. The stereoisomers of cyclo(-D-Leu-D-Pro) have different effects on bacterial cells, with one being more potent than the other.</p>Formule :C11H18N2O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :210.27 g/molH-INTVNSNTLPVLR^-OH
<p>Peptide H-INTVNSNTLPVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-YGRKKRRQRRRGGVGNDFFINHETTGFATEW-OH
Peptide LCBiot-YGRKKRRQRRRGGVGNDFFINHETTGFATEW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-84
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,588 g/molFluor-AEEEIYGEFEAKKKK-OH
Peptide Fluor-AEEEIYGEFEAKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSVVLGKKQRFHSWG-NH2
<p>Peptide H-NSVVLGKKQRFHSWG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CAQAGRQKKPVTYLEDSDDDF-OH
<p>Peptide Ac-CAQAGRQKKPVTYLEDSDDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DDNPNLPR^-OH
<p>Peptide H-DDNPNLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FYEAFSK^-OH
<p>Peptide H-FYEAFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5FAM-HQSYVDPWMLDH-OH
<p>Peptide 5FAM-HQSYVDPWMLDH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVIQHFQEK^-OH
Peptide H-AVIQHFQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-QYTSIHHGVVEVD-OH
<p>Peptide LCBiot-QYTSIHHGVVEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SP^YQLVLQHSR^-OH
<p>Peptide H-SP^YQLVLQHSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HLA leader peptide LVL (heavy-labeled)
Fragment of the signal peptide from endogenous HLA Class I molecules which is also found in viral glycoproteins, for example human Cytomegalovirus (hCMV) protein UL40. When presented on a cell surface via HLA-E molecules, the HLA-peptide complex binds NKG2A receptors on Natural Killer (NK) cells and some CD8⁺ cytotoxic T cells to reduce their cytotoxic activity. Blocking this interaction is an attractive opportunity for immune checkpoint (IC) approach therapies. This is relevant in both cancer therapies, and viral infections, where endogenous HLA Class I peptide presentation is exploited to escape immune attack.Peptide H-VMAPRTLL^-OH is a heavy-labeled version of PP45242, and is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NGFYPATR^-OH
<p>Peptide H-NGFYPATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FL^SLDYIPQR-OH
<p>Peptide H-FL^SLDYIPQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LDDRHDDGLDDMKDEEY-NH2
Peptide Ac-LDDRHDDGLDDMKDEEY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSSFNPAALSR^-OH
Peptide H-NSSFNPAALSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Le
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C90H167N15O16Masse moléculaire :1,715.38 g/molAc-ASRMEEVD-OH
Peptide Ac-ASRMEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DCP-OH
<p>Peptide H-DCP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AYATEPHAK^-OH
Peptide H-AYATEPHAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
<p>Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-18
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,667.8 g/molCMVpp65 - 84 (IRETVELRQYDPVAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,760 g/molCMVpp65 - 132 (AELEGVWQPAAQPKR)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,679.9 g/molH-VLNQFDDAGIVTR^-OH
<p>Peptide H-VLNQFDDAGIVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-110
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,750 g/molFmoc-ß-Ala-Wang Resin (100-200 mesh) 1% DVB
<p>Fmoc-ß-Ala-Wang Resin (100-200 mesh) 1% DVB is a chemical reagent that is used for the synthesis of peptides and proteins. It is an important tool for the study of protein interactions, activation, ligand binding and receptor binding. Fmoc-ß-Ala-Wang Resin (100-200 mesh) 1% DVB is also used as a high purity reagent for life science research.</p>Degré de pureté :Min. 95%H-YLPNPALQR^-OH
<p>Peptide H-YLPNPALQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-1-oxo-3-phenylpropan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino ]-4-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-4-[[(2S)-2-[[(2S)-2,6-diaminohexanoyl]amino
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C47H70N14O10Masse moléculaire :991.17 g/molH-GIYDGDLK^-OH
<p>Peptide H-GIYDGDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PAFSAIR^-OH
<p>Peptide H-PAFSAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 19
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,785.1 g/molLCBiot-AHGVTSAPDTRPAPGSTAPPA-OH
<p>Peptide LCBiot-AHGVTSAPDTRPAPGSTAPPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NVPLPVIAELPPK^-OH
<p>Peptide H-NVPLPVIAELPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LEAR^-OH
<p>Peptide Ac-LEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
![(4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-1-oxo-3-phenylpropan-2-yl]amino]-5-(diaminomethyl…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50018.webp&w=3840&q=75)
