CymitQuimica logo
Peptides

Peptides

Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.

Sous-catégories appartenant à la catégorie "Peptides"

30433 produits trouvés pour "Peptides"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • HLA-A2 140-149 (HLA-A*02:01)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50792

    ne
    À demander
  • Human Histatin 2


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C158H211N45O44
    Masse moléculaire :3,444.6 g/mol

    Ref: 3D-PP50610

    ne
    À demander
  • H-LLIYAASSLQSGVPSR^-OH


    <p>Peptide H-LLIYAASSLQSGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48137

    ne
    À demander
  • H-YGLVTYATYPK^-OH


    <p>Peptide H-YGLVTYATYPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42195

    ne
    À demander
  • H-VMAPRTLL^-OH


    <p>Peptide H-VMAPRTLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41941

    ne
    À demander
  • Myelin Basic Protein (87-99) (human, bovine, rat)

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C74H114N20O17
    Masse moléculaire :1,555.84 g/mol

    Ref: 3D-PP49994

    ne
    À demander
  • Ac-RRRK-NH2


    <p>Peptide Ac-RRRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44407

    ne
    À demander
  • Ac-NRV-NH2


    <p>Peptide Ac-NRV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44729

    ne
    À demander
  • H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2


    <p>Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).</p>

    Ref: 3D-PP41946

    ne
    À demander
  • H-LNIPTDVLK^-OH


    <p>Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42147

    ne
    À demander
  • H-VVGADGVGK^-OH


    <p>Peptide H-VVGADGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47455

    ne
    À demander
  • H-LLETECPQYIR^-OH


    <p>Peptide H-LLETECPQYIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41189

    ne
    À demander
  • LCBiot-PSKPSKRSFIEDLLFNKV-OH


    <p>Peptide LCBiot-PSKPSKRSFIEDLLFNKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48789

    ne
    À demander
  • H-YNSGK^-OH


    <p>Peptide H-YNSGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41211

    ne
    À demander
  • R8-BAD amide (rat)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50237

    ne
    À demander
  • H-YLAEVATGEK^-OH


    <p>Peptide H-YLAEVATGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48747

    ne
    À demander
  • H-IIAPPER^-OH


    <p>Peptide H-IIAPPER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48484

    ne
    À demander
  • Protein AMBP [279-290]


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50808

    ne
    À demander
  • CMVpp65 - 126 (ATVQGQNLKYQEFFW)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,859.1 g/mol

    Ref: 3D-PP50858

    ne
    À demander
  • H-ELHHLQEQNVSNA^FLDK^-OH


    <p>Peptide H-ELHHLQEQNVSNA^FLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41121

    ne
    À demander
  • H-GILGFVFTL^-OH


    <p>Peptide H-GILGFVFTL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47412

    ne
    À demander
  • H-ILLAELEQLK^-OH


    <p>Peptide H-ILLAELEQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47697

    ne
    À demander
  • Fluor-YGGF-OH


    <p>Peptide Fluor-YGGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46762

    ne
    À demander
  • H-YTAGVSPK^-OH


    <p>Peptide H-YTAGVSPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41597

    ne
    À demander
  • H-LSARLAF-NH2


    <p>Peptide H-LSARLAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46836

    ne
    À demander
  • Ac-DDTSRMEEVD-OH


    <p>Peptide Ac-DDTSRMEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48167

    ne
    À demander
  • H-YSLEPVAVELK^-OH


    <p>Peptide H-YSLEPVAVELK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45181

    ne
    À demander
  • Ac-FAQ-OH


    <p>Peptide Ac-FAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45902

    ne
    À demander
  • H-VALYVDWIR^-OH


    <p>Peptide H-VALYVDWIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41341

    ne
    À demander
  • Abz-APEEIMRRQ-EDDnp


    <p>Peptide Abz-APEEIMRRQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48931

    ne
    À demander
  • 5TAMRA-DPIYALSWSGMA-OH


    <p>Peptide 5TAMRA-DPIYALSWSGMA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49156

    ne
    À demander
  • H-V^IFDANAPVAVR^-OH


    <p>Peptide H-V^IFDANAPVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46513

    ne
    À demander
  • SIVmac239 - 57


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,515.6 g/mol

    Ref: 3D-PP50202

    ne
    À demander
  • H-YFQATTLGLPLEISK^^-OH


    <p>Peptide H-YFQATTLGLPLEISK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40655

    ne
    À demander
  • Ac-ILRTQESEC-NH2


    <p>Peptide Ac-ILRTQESEC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49578

    ne
    À demander
  • H-GQSEVSAAQLQER^-OH


    <p>Peptide H-GQSEVSAAQLQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41303

    ne
    À demander
  • H-LFLQFGAQGSPFLK^-OH


    <p>Peptide H-LFLQFGAQGSPFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44053

    ne
    À demander
  • Ac-GQLIDSMANSFVGTR-NH2


    <p>Peptide Ac-GQLIDSMANSFVGTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49035

    ne
    À demander
  • H-V^V^GGL^V^ALR^-OH


    <p>Peptide H-V^V^GGL^V^ALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45761

    ne
    À demander
  • HXB2 gag NO-116/aa461 - 475


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,663.8 g/mol

    Ref: 3D-PP49954

    ne
    À demander
  • H-ISASR^-OH


    <p>Peptide H-ISASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40069

    ne
    À demander
  • H-NFPSPVDAAFR^-OH


    <p>Peptide H-NFPSPVDAAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47629

    ne
    À demander
  • H-VHVQFFDDSPTR^-OH


    Peptide H-VHVQFFDDSPTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46212

    ne
    À demander
  • Ac-DHLASLWWGTEL-NH2


    <p>Peptide Ac-DHLASLWWGTEL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45457

    ne
    À demander
  • β-Amyloid (1-40)

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C194H295N53O58S1
    Masse moléculaire :4,329.86 g/mol

    Ref: 3D-PP50385

    ne
    À demander
  • H-GQNDTSQTSSPS-Phosphocolamine


    <p>Peptide H-GQNDTSQTSSPS-Phosphocolamine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48634

    ne
    À demander
  • H-SYTITGLQPGTDYK^-OH


    <p>Peptide H-SYTITGLQPGTDYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47345

    ne
    À demander
  • H-GTYHTNEAK^-OH


    <p>Peptide H-GTYHTNEAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40991

    ne
    À demander
  • H-STELLIR^-OH


    <p>Peptide H-STELLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47652

    ne
    À demander
  • H-FMDVYQR^-OH


    <p>Peptide H-FMDVYQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41787

    ne
    À demander