
Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30471 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-SYGIPFIETSAK^-OH
<p>Peptide H-SYGIPFIETSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-R^TPDYFL-OH
<p>Peptide H-R^TPDYFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HEIPVLP^NR-OH
<p>Peptide H-HEIPVLP^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 20 (VQHTYFTGSEVENVS)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,696.8 g/molH-FQPTLLTLPR^-OH
<p>Peptide H-FQPTLLTLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DVINEAWFPEDQR^-OH
<p>Peptide H-DVINEAWFPEDQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>β-Amyloid (1-38)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C184H277N51O56SMasse moléculaire :4,131.6 g/molAoa-KDEL-OH
<p>Peptide Aoa-KDEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-VAAWTLKAAA-NH2
<p>Peptide Ac-VAAWTLKAAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VINDFVEK^-OH
<p>Peptide H-VINDFVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASNTAEVFFDGVR^-OH
<p>Peptide H-ASNTAEVFFDGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-PVKRRLDL-OH
<p>Peptide Biot-PVKRRLDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLQGLPR^-OH
<p>Peptide H-VLQGLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SANILLDEAF^TAK-OH
<p>Peptide H-SANILLDEAF^TAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SNRP70
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-DAEFR^HDSGYEVHHQ-OH
<p>Peptide H-DAEFR^HDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGGFLRRIRPKLK^WDNQ-OH
<p>Peptide H-YGGFLRRIRPKLK^WDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPLTNAIK^-OH
<p>Peptide H-FPLTNAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STDTAYMELSSLR^-OH
<p>Peptide H-STDTAYMELSSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVL^VQREKDL^PNYNWNSFGL^RF-NH2
<p>H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formule :C258H401N79O78Masse moléculaire :5,857.5 g/molH-TANDLNLLILR^-OH
<p>Peptide H-TANDLNLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HEAWITLEK^-OH
<p>Peptide H-HEAWITLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>δ-MSH
<p>Peptide ÎŽ-MSH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C74H99N21O16SMasse moléculaire :1,570.81 g/molH-FFVPPFQQSPR^-OH
<p>Peptide H-FFVPPFQQSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QFYDQALQQAVVDDDANNAK^-OH
<p>Peptide H-QFYDQALQQAVVDDDANNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLPAPITR^-OH
<p>Peptide H-DLPAPITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NFLINETAR^-OH
<p>Peptide H-NFLINETAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLWEWASVR^-OH
<p>Peptide H-YLWEWASVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DFTPAAQAAFQK^-OH
<p>Peptide H-DFTPAAQAAFQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-G^PSLFPLAPSSK^-OH
<p>Peptide H-G^PSLFPLAPSSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLHPLEGAVVIIFK^-OH
<p>Peptide H-VLHPLEGAVVIIFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSQVWLGR^-OH
<p>Peptide H-NSQVWLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPK^PIPGNW-OH
<p>Peptide H-DPK^PIPGNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cbz-D-Arg-Gly-Arg-pNA
<p>Peptide Cbz-D-Arg-Gly-Arg-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPFPIIV^-OH
<p>Peptide H-GPFPIIV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CKSLLWKKVLP-NH2
<p>Peptide Ac-CKSLLWKKVLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Aoa-DYKDDDDK-OH
<p>Peptide Aoa-DYKDDDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IDIDIER^-OH
<p>H-IDIDIER-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-EVGDWRK^-OH
<p>Peptide H-EVGDWRK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPVSDR^-OH
<p>Peptide H-TPVSDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CRAELEKHGYKMETS
<p>Ac-CRAELEKHGYKMETS is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Melanocyte Protein PMEL 17 (44-59) (human, bovine, mouse)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C95H137N27O28Masse moléculaire :2,105.3 g/molRibosomal protein L3 peptide (202-222) amide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C114H182N42O25SMasse moléculaire :2,573 g/molH-QGGFLGLSNIK^-OH
<p>Peptide H-QGGFLGLSNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-RFAAKAA-OH
<p>Peptide Ac-RFAAKAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>pE-MAVKKYLNSILN-NH2
CAS :<p>pE-MAVKKYLNSILN-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-EIDTVLPNK^-OH
<p>Peptide H-EIDTVLPNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EGKKLVAASQAAL^GL-OH
<p>Peptide H-EGKKLVAASQAAL^GL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SEVAHR^-OH
<p>Peptide H-SEVAHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NVDLSTFYQNR^-OH
<p>Peptide H-NVDLSTFYQNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
