Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29608 produits trouvés pour "Peptides"
H-EQLTPLIK^-OH
Peptide H-EQLTPLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLDFTELDVAAEK^-OH
Peptide H-SLDFTELDVAAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SSTGSIDMVD-OH
Peptide Ac-SSTGSIDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IFVGGLSPDTPEEK^-OH
Peptide H-IFVGGLSPDTPEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Amyloid Beta-Protein (40-1)
CAS :Amyloid Beta-Protein (40-1) is a peptide that is found in the brain, and is thought to be involved in Alzheimer’s disease. Amyloid Beta-Protein (40-1) has been shown to inhibit protein interactions and activator functions, as well as act as a ligand for receptors. This protein can be used as a research tool for studying ion channels and antibodies. It also has high purity and can be used for life science experiments.Formule :C194H295N53O58SDegré de pureté :Min. 95%Masse moléculaire :4,329.8 g/molH-VYPWTQR-NTPEGBiot
Peptide H-VYPWTQR-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HLA-A*02:01 Human LMP2 LLWTLVVLL
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-REEE-NH2
Peptide H-REEE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EFFVGLSK^-OH
Peptide H-EFFVGLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVVVGAGCVGK^-OH
Peptide H-LVVVGAGCVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IECFDSVEISGVEDR^-OH
Peptide H-IECFDSVEISGVEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ala-Tyr-Pro-Gly-Lys-Phe-OH
CAS :H-Ala-Tyr-Pro-Gly-Lys-Phe-OH is a peptide that activates toll-like receptor 4 (TLR4). It is a potent inhibitor of the enzyme phospholipase A2 and has been shown to inhibit the production of proinflammatory cytokines, such as IL1β, IL6, IL8, and TNFα. This peptide also has anti-inflammatory effects on autoimmune diseases, such as rheumatoid arthritis. H-Ala-Tyr-Pro-Gly-Lys-Phe-OH has been shown to inhibit prostate cancer cell growth in vitro and in vivo. It appears to exert its action by interfering with the transcriptional process at the level of RNA polymerase II. The mechanism may involve inhibition of the activation of basic fibroblast cells or suppression of epidermal growth factor signaling. H-Ala-Tyr - Pro - Gly - Lys - Phe -
Formule :C34H47N7O8Degré de pureté :Min. 95%Masse moléculaire :681.78 g/molSULT1B1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SULT1B1 antibody, catalog no. 70R-2607Degré de pureté :Min. 95%H-STGGISVPGPMGPSGPR^-OH
Peptide H-STGGISVPGPMGPSGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Lys(Palmitoyl-Glu-OtBu)-OH
CAS :This is a building block for peptide synthesis. It is a protected lysine derivative that can be used in the formation of peptides. This functionalized lysine derivative can be deprotected and reacted with other amino acids to form peptides. The protecting group, Fmoc, protects the lysine from unwanted reactions during the synthesis process. The side chain, Palmitoyl-Glu-OtBu, allows for the attachment of other molecules to the lysine side chain.Formule :C46H69N3O8Degré de pureté :Min. 95%Masse moléculaire :792.08 g/molH-CRDTDLPFELRGELV-NH2
Peptide H-CRDTDLPFELRGELV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Phe-Ser-Leu-Leu-Arg-Tyr-NH2
CAS :This is a synthetic peptide that was originally isolated from human colon tissue. It has been shown to sensitize dorsal root ganglia neurons in vitro, producing a response to the neurotransmitter acetylcholine. This peptide also induces apoptosis in neuronal cells and increases the permeability of blood vessels in tissues by activating vasoactive intestinal peptide (VIP) receptors. The effects of this peptide were studied in humans with bowel disease or inflammatory bowel disease. It was found that it may be effective for treating these diseases as well as necrosis factor-mediated inflammation. This peptide is also known to activate IL-10, which is an anti-inflammatory cytokine.Formule :C39H60N10O8Degré de pureté :Min. 95%Masse moléculaire :796.98 g/mol[Des-Arg9]-Bradykinin
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C44H61N11O10Masse moléculaire :904.04 g/molH-Ser-Phe-Leu-Leu-Arg-Asn-Pro-Asn-Asp-Lys-Tyr-Glu-Pro-Phe-NH2
CAS :H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-Asn-Asp-Lys-Tyr-Glu-Pro-Phe is a peptide that is activated by incubation with collagen. It has been shown to have an inhibitory effect on thrombin receptor and the activation of coagulation factors, which may be due to its ability to desensitize the receptor. HSLRAPAP can also be used in cancer therapy. In animal studies, it has been shown to inhibit tumor growth and metastasis. HSLRAPAP has also been shown to stimulate the production of platelets in animals, which may account for its antiplatelet properties.Formule :C83H120F3N21O24Degré de pureté :Min. 95%LCBiot-HMRSAMSGLHLVKRR-OH
Peptide LCBiot-HMRSAMSGLHLVKRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
gp100 (209-217)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C47H74N10O14SMasse moléculaire :1,035.2 g/molAsp-Asn-Glu-Asn-Val-Val-Asn-Glu-Tyr-Ser-Ser-Glu-Le
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C73H113N19O32Masse moléculaire :1,768.79 g/molSIVmac239 - 89
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,441.7 g/molCREB327 (113-126)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C76H131N25O21Masse moléculaire :1,731.05 g/molH-NIETIINTFHQYSVK^-OH
Peptide H-NIETIINTFHQYSVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVMDDFAAFVEK^-OH
Peptide H-AVMDDFAAFVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Ile-Glu-Pro-Asp-AMC
CAS :AMC conjugated molecule targeting caspase-8 and granzyme B
Formule :C32H41N5O11Degré de pureté :Min. 97 Area-%Couleur et forme :PowderMasse moléculaire :671.7 g/molH-VLAVTDSPAR^-OH
Peptide H-VLAVTDSPAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ser-Phe-Leu-Leu-Arg-OH
CAS :H-Ser-Phe-Leu-Leu-Arg-OH is a cyclic peptide that has been shown to have cytotoxic effects against cells of the atherosclerotic lesion in vivo. It also has antioxidant properties and can be used as a biocompatible polymer for the treatment of autoimmune disease. This drug is not potent enough to be used as an antibacterial agent but is effective against some strains of Mycobacterium tuberculosis and Mycobacterium avium complex. This drug binds to integrin receptors on cells, which may account for its low potency.Formule :C30H50N8O7Degré de pureté :Min. 95%Masse moléculaire :634.77 g/molH-TVLAVFGK^-OH
Peptide H-TVLAVFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EP^QVYTLPPSR^-OH
Peptide H-EP^QVYTLPPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LFLEPIGADIALLK^-OH
Peptide H-LFLEPIGADIALLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.VP1 14-22 (HLA-B*07:02)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolBQ-123 Sodium Salt
CAS :BQ-123 is a cyclic peptide that blocks the endothelin-A receptor. It has been shown to be an effective treatment for pain and inflammation associated with osteoarthritis, rheumatoid arthritis, and other inflammatory conditions. BQ-123 binds to the endothelin-A receptor, which is located on the surface of cells in many tissues throughout the body. When bound, it inhibits intracellular calcium concentrations by reducing voltage-gated calcium channels and prevents the release of neurotransmitters. BQ-123 also has a stabilizing effect on hydrogen bonds due to its charged side chains. This property may account for its ability to form stable complexes with other proteins, inhibiting their function. BQ-123 has been shown to have an active binding site on cyclic AMP response element binding protein (CREB) that inhibits CREB activity, thereby reducing protein synthesis. It also blocks cyclic GMP (cGMP)-dependent protein kinFormule :C31H42N6O7Degré de pureté :Min. 95%Masse moléculaire :610.70 g/molH-SHALQLNNR^-OH
Peptide H-SHALQLNNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ala-AMC
CAS :Ala-AMC is a fluorescent peptide that binds to the receptor AMPA and activates it. This product is used in research as a tool for studying protein interactions, cellular biology and pharmacology.Formule :C13H14N2O3Degré de pureté :Min. 95%Masse moléculaire :246.26 g/molPr-EIR^-OH
Peptide Pr-EIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Tyr-Val-Gly
CAS :Ac-Tyr-Val-Gly is a mitochondrial protein that regulates mitochondrial functions and is involved in the regulation of apoptosis. Ac-Tyr-Val-Gly interacts with nuclear DNA and regulates transcription, translation, and replication. Ac-Tyr-Val-Gly has been shown to be toxic to liver cells; however, it has been shown to have no effect on neuronal death or apoptosis pathway. These effects may be due to its ability to induce proteolytic activity in neurons and its ability to activate proapoptotic proteins such as Bax.Formule :C18H25N3O6Degré de pureté :Min. 95%Masse moléculaire :379.41 g/molH-LGADMEDVCGR^-OH
Peptide H-LGADMEDVCGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Sex pheromone, iCF10
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C40H67N7O9Masse moléculaire :790 g/molH-Gly-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Gly-2-ClTrt-Resin (200-400 mesh) 1% DVB is an amine resin that is used as a building block in the synthesis of peptides. It is composed of 2,4,6-trinitrobenzene sulfonic acid (TNB), glycolic acid and 2,2'-dithio bis(ethane sulfonic acid) (DTES). This resin has a high level of reactivity with thiols and can be used to synthesize peptides. H-Gly-2-ClTrt-Resin (200-400 mesh) 1% DVB is also used for the synthesis of alcohols.Formule :C2H4NORDegré de pureté :Min. 95%Masse moléculaire :58.06 g/molH-EQLSSVSSFER^-OH
Peptide H-EQLSSVSSFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Cys(Pam)2-OH
CAS :Fmoc-Cys(Pam)2-OH is a building block that can be used in the synthesis of lipopeptides. It is used in the research of vaccines and has been shown to target tumor cells.
Formule :C53H83NO8SDegré de pureté :Min. 95%Masse moléculaire :894.32 g/molH-Tyr-Ala-Pro-Gly-Lys-Phe-NH2
H-Tyr-Ala-Pro-Gly-Lys-Phe-NH2 is a synthetic peptide that can activate the PAR4 receptor. The PAR4 receptor is activated by proteolytic cleavage, which occurs when PAR4 interacts with the enzyme thrombin. Activation of the PAR4 receptor leads to vasodilation and increased blood flow. H-Tyr-Ala-Pro-Gly-Lys-Phe NH2 has shown potential for use in cardiovascular diseases such as hypertension, which is characterized by elevated blood pressure.Formule :C34H48N8O7Degré de pureté :Min. 95%Masse moléculaire :680.81 g/molH-REEEDK-NH2
Peptide H-REEEDK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FSP^DDSAGASALLR-OH
Peptide H-FSP^DDSAGASALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
6Azido-TFYGGRPKRNNFLRGIR-NH2
Peptide 6Azido-TFYGGRPKRNNFLRGIR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Masse moléculaire :2,190.56 g/mol5Fam-FLPSDCFPSV-OH
Peptide 5Fam-FLPSDCFPSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![[Des-Arg9]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50709.webp&w=3840&q=75)
