CymitQuimica logo
Peptides

Peptides

Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.

Sous-catégories appartenant à la catégorie "Peptides"

30471 produits trouvés pour "Peptides"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • Ac-CGPGLGEYMFDKETLSD-OH


    <p>Peptide Ac-CGPGLGEYMFDKETLSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44159

    ne
    À demander
  • LCBiot-ENPVVHFFKNIVTPR-OH


    <p>Peptide LCBiot-ENPVVHFFKNIVTPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46334

    ne
    À demander
  • H-QLLLSAALSAGK^-OH


    <p>Peptide H-QLLLSAALSAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41961

    ne
    À demander
  • H-GKWERPFEVK^-OH


    <p>Peptide H-GKWERPFEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40207

    ne
    À demander
  • GAD65 (206-220)

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C86H129N15O24
    Masse moléculaire :1,757.07 g/mol

    Ref: 3D-PP50071

    ne
    À demander
  • SIVmac239 - 111


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,695 g/mol

    Ref: 3D-PP50212

    ne
    À demander
  • H-QQTVTLLPAADLDDFSK^-OH


    <p>Peptide H-QQTVTLLPAADLDDFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48903

    ne
    À demander
  • Cecropin A

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C136H233N33O29
    Masse moléculaire :2,794.55 g/mol

    Ref: 3D-PP50276

    ne
    À demander
  • LCBiot-GTAG-OH


    <p>Peptide LCBiot-GTAG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46077

    ne
    À demander
  • H-HGEGTFTSDLSKQMEEEAVRLF^IEWLKNGGPSSGAPPPS-NH2


    <p>Peptide H-HGEGTFTSDLSKQMEEEAVRLF^IEWLKNGGPSSGAPPPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47182

    ne
    À demander
  • H-GGPLDGTYR^-OH


    <p>Peptide H-GGPLDGTYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48238

    ne
    À demander
  • Prostatic Acid Phosphatase (248 - 286), PAP (248 - 286)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C203H342N60O54S2
    Masse moléculaire :4,551.5 g/mol

    Ref: 3D-PP50413

    ne
    À demander
  • LCBiot-SGVYKVAYDWQH-NH2


    <p>Peptide LCBiot-SGVYKVAYDWQH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45909

    ne
    À demander
  • H-KFRKAFKRFF-NTPEGBiot


    <p>Peptide H-KFRKAFKRFF-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49469

    ne
    À demander
  • H-YYTPVLAK^-OH


    <p>Peptide H-YYTPVLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40101

    ne
    À demander
  • H-LQTAPVPMPDLK^-OH


    <p>Peptide H-LQTAPVPMPDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49192

    ne
    À demander
  • GP120 - W61D - 3


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,906.3 g/mol

    Ref: 3D-PP50096

    ne
    À demander
  • H-PLIYLRLLRGQFC-NH2


    <p>Peptide H-PLIYLRLLRGQFC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43516

    ne
    À demander
  • H-FQSVFTVTR^-OH


    <p>Peptide H-FQSVFTVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43057

    ne
    À demander
  • Ac-MRTPRCG-NH2


    <p>Peptide Ac-MRTPRCG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46797

    ne
    À demander
  • 5Fam-GDYSHCSPLRYYPWWKCTYPDPEGGG-NH2


    <p>Peptide 5Fam-GDYSHCSPLRYYPWWKCTYPDPEGGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45233

    ne
    À demander
  • H-LTVGAAQVPAQLLVGALR^-OH


    <p>Peptide H-LTVGAAQVPAQLLVGALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40025

    ne
    À demander
  • H-DRVYIHPFHL-NH2


    <p>Peptide H-DRVYIHPFHL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46870

    ne
    À demander
  • H-MVTGVASALSSR^-OH


    <p>Peptide H-MVTGVASALSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48210

    ne
    À demander
  • H-DPPSEPSPLEAEFQR^-OH


    <p>Peptide H-DPPSEPSPLEAEFQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49713

    ne
    À demander
  • FMRF-like neuropeptide flp-11-2


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C54H92N20O14S
    Masse moléculaire :1,277.4 g/mol

    Ref: 3D-PP50239

    ne
    À demander
  • H-IL^DTAGL^EEY-OH


    <p>Peptide H-IL^DTAGL^EEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42501

    ne
    À demander
  • Dynorphin A (1-17)

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C99H155N31O23
    Masse moléculaire :2,147.5 g/mol

    Ref: 3D-PP51044

    ne
    À demander
  • Fmoc-MRWQEMGYIFYPRKLR-OH


    <p>Peptide Fmoc-MRWQEMGYIFYPRKLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45096

    ne
    À demander
  • H-FPEVDVLTK^-OH


    <p>Peptide H-FPEVDVLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41749

    ne
    À demander
  • LCBiot-VLDFAPPGA-OH


    <p>Peptide LCBiot-VLDFAPPGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49158

    ne
    À demander
  • H-SSKITHR^IHWESASLL-OH


    <p>Peptide H-SSKITHR^IHWESASLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42461

    ne
    À demander
  • GTPase NRas (55-64)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50780

    ne
    À demander
  • Intermedin / Adrenomedullin-2 (Human) - I-125 Labeled


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50519

    ne
    À demander
  • H-GIV^E-OH


    <p>Peptide H-GIV^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43255

    ne
    À demander
  • H-YLGEEYVK^^-OH


    <p>Peptide H-YLGEEYVK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40223

    ne
    À demander
  • Cyc-Biot-YCWSQYLCY-NH2


    <p>Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45825

    ne
    À demander
  • H-VNVEDAGGETLGR^^-OH


    <p>Peptide H-VNVEDAGGETLGR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44546

    ne
    À demander
  • H-VTFLGLQHWVPELAR^-OH


    <p>Peptide H-VTFLGLQHWVPELAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40913

    ne
    À demander
  • pE-RPRLSHKGPMPF-OH


    <p>Peptide pE-RPRLSHKGPMPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
    Masse moléculaire :1,533.82 g/mol

    Ref: 3D-PP49915

    ne
    À demander
  • Lys-Asp-Cys


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C13H24N4O6S1
    Masse moléculaire :364.42 g/mol

    Ref: 3D-PP50651

    ne
    À demander
  • Ac-CETVSTQELYS-NH2


    <p>Peptide Ac-CETVSTQELYS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44842

    ne
    À demander
  • M 1145

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C128H205N37O32
    Masse moléculaire :2,774.26 g/mol

    Ref: 3D-PP50472

    ne
    À demander
  • Thr-Met-Ile


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C15H29N3O5S1
    Masse moléculaire :363.47 g/mol

    Ref: 3D-PP50661

    ne
    À demander
  • H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2


    <p>Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46273

    ne
    À demander
  • H-G^^G^^G-OH


    <p>Peptide H-G^^G^^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49846

    ne
    À demander
  • Ac-DIEVLQEQIRC-NH2


    <p>Peptide Ac-DIEVLQEQIRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46109

    ne
    À demander
  • Ac-CETVFHRVSQDGLDL-NH2


    <p>Peptide Ac-CETVFHRVSQDGLDL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46612

    ne
    À demander
  • GP120 - W61D - 16


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,678.9 g/mol

    Ref: 3D-PP50873

    ne
    À demander