Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
29610 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Atrial Natriuretic Factor (1-28)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C127H203N45O39S3Masse moléculaire :3,080.46 g/molBiotinylated TAT (47-57)
Biotinylated Tat Peptide available in the trifluroacetate salt form. TAT(Transactivated-transcripiton) Peptide Derived from the HIV TAT Protein, is a Cell-Penetrating Peptide which has the ability to transport itself across cell membranes independently. Cell penetrating peptides (CPPs) can be used to carry other molecules into the cell and therefore can be used in many applications. Such applications may include: drug delivery, where small drug peptides or nucleic acids can be delivered into target cells or where CPPs are conjugated to imaging agents such as fluorescent dyes or radiolabeled molecules they can be used for in vivo or in vitro imaging in diagnostics.Formule :C74H132N34O16SDegré de pureté :Min. 95%Masse moléculaire :1,786.16 g/mol(4S)-4-[[(2S)-3-Carboxy-2-[[(2S,3R)-2-[[(2R)-2-[[(2S,3S)-2-[[(2S)-3-carboxy-2-[[(2R)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-sulfanylp ropanoyl]amino]propanoyl]amino]-3-methylpentanoyl]amino]-3-sulfanylpropanoyl]amino]-3-hydroxybutanoyl]amino]propanoyl]amin
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C44H68N10O18S2Masse moléculaire :1,089.2 g/molCyclo(Arg-Gly-Glu-D-Phe-Lys)
Cyclo(Arg-Gly-Glu-D-Phe-Lys) is a cyclic peptide that has been used as an inhibitor of the signaling pathway in cells. Cyclo(Arg-Gly-Glu-D-Phe-Lys) binds to the receptor, which may be associated with an ion channel and the activation of a G protein. This peptide can act as a competitive inhibitor of other ligands for this receptor. Cyclo(Arg-Gly-Glu-D-Phe-Lys) is also known to be an activator for some receptors, including the angiotensin II type 1 receptor (AT1). This peptide has been used as a research tool to study receptor function and cellular signaling pathways. It is also being investigated for use in antibody production.Formule :C28H43N9O7Degré de pureté :Min. 95%Masse moléculaire :617.71 g/molH-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).H-LNIPTDVLK^-OH
Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ARTKQTARKSTGGKA-NH2
Peptide H-ARTKQTARKSTGGKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ghrelin (Human, 1-14)
Amino acids 1-14 of Ghrelin, a peptide hormone that is found in the stomach, brain and other tissues. Ghrelin associates with growth hormone secretagogue receptors (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. As a result it is able to influence the body in various ways such as stimulating appetite, nutrient sensing, meal initiation and the regulation of insulin resistance, diabetes and obesity. Its wider functions are also associated with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.Formule :C76H121N22O24Degré de pureté :Min. 95%Masse moléculaire :1,725.94 g/molCMVpp65 - 53 (ENTRATKMQVIGDQY)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,754 g/molAla-Asp-Ser-Asp-Pro-Arg
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C25H41N9O12Masse moléculaire :659.65 g/molDes-n-Octanoyl-[Ser3]-Ghrelin (Human, 1-14)
Des-n-Octanoyl-[Ser3]-Ghrelin (Human, 1-14) is a non-Acylated Analog of Ghrelin (Human, 1-14), amino acids 1-14 of the peptide hormone Ghrelin. This peptide does not contain the unique N-octanoyl group which is linked to Ghrelin's third serine residue covalently and which allows Ghrelin to associate with the growth hormone secretagogue receptor (GHS-R). Through interaction with the GHS-R, Ghrelin can exert its various effects on the body such as stimulating appetite, nutrient sensing, meal initiation and the regulation of insulin resistance, diabetes and obesity. Its wider functions are also associated with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.Formule :C68H106N22O23Degré de pureté :Min. 95%Masse moléculaire :1,599.74 g/molH-SSDTEENVK^-OH
Peptide H-SSDTEENVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ARV^YIHPF-OH
Peptide H-ARV^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
α-Neo-Endorphin, porcine
CAS :Custom research peptide; min purity 95%.Formule :C60H89N15O13Degré de pureté :Min. 95%Masse moléculaire :1,228.47 g/molH-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2
H-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2 is a cyclic peptide that contains the sequence of amino acids Arg, Gly, Asp, D, Tyr and Lys. It is a peptide macrocycle that has been shown to be effective against tumor cells. This peptide has been derivatized for targeting purposes and has been shown to be an effective imaging agent for tumor cells in vivo. H-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2 is also biochemically active and can inhibit the growth of cancer cells through multiple mechanisms.Formule :C59H87N19O18Degré de pureté :Min. 95%Masse moléculaire :1,350.47 g/molH-SSSHPIFHR^-OH
Peptide H-SSSHPIFHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Gly-Gly-Gly-Gly-Arg-Gly-Asp-Ser-Pro-OH
Gly-Gly-Gly-Gly-Arg-Gly-Asp-Ser-Pro is a peptide used as an activator in research. It can be used to study protein interactions and the effects of ligands on ion channels and receptors. Gly residues are able to form hydrogen bonds, which is why they are often used as spacers in proteins. This peptide has a high purity and CAS number.
Formule :C28H46N12O13Degré de pureté :Min. 95%Masse moléculaire :758.75 g/molH-HEIPVLP^NR-OH
Peptide H-HEIPVLP^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 20 (VQHTYFTGSEVENVS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,696.8 g/molLCBiot-NLRKSGTLGHPGSL-OH
Peptide LCBiot-NLRKSGTLGHPGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Suc-Glu-Ala-Leu-Phe-Gln-pNA
Suc-Glu-Ala-Leu-Phe-Gln-pNA is a substrate for human rhinovirus 3C protease. The peptide is a mixture of four amino acids and has been synthesized to serve as an inhibitor of the HRV3C protease enzyme. Suc-Glu-Ala-Leu-Phe-Gln-pNA is expected to inhibit the HRV3C protease by binding to the active site, thereby preventing cleavage of viral proteins that are needed for replication.Formule :C38H50N8O13Degré de pureté :Min. 95%Masse moléculaire :826.87 g/mol(Gln²²,Asn²³)-Amyloid β-Protein (1-40)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C194H297N55O56SMasse moléculaire :4,327.9 g/molHiGom
HiGom is a venom that belongs to the group of proteins that can produce reactive oxygen species. It has been shown to inhibit mitochondrial membrane potential, cellular viability, and the production of reactive oxygen species. HiGom has also been shown to inhibit the production of inflammatory cytokines and chemokines in response to chronic pain. This protein may be useful for cancer treatment as it has been shown to inhibit tumor growth by inducing apoptosis and inhibiting angiogenesis.Formule :C92H150N38O23S4Degré de pureté :Min. 95%Masse moléculaire :2,284.72 g/molCMVpp65 - 16 (YTPDSTPCHRGDNQL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,703.8 g/molCMVpp65 - 76 (HFGLLCPKSIPGLSI)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,582 g/molNangibotide
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C54H82N14O22S2Masse moléculaire :1,343.44 g/molFmoc-GRGDSPK-OH
Peptide Fmoc-GRGDSPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Desmin , human, recombinant
Desmin, human, recombinant is a protein that is commonly used in research studies. It is produced using E.coli as the host organism. Desmin plays a crucial role in maintaining the structural integrity of muscle cells. It forms a network of intermediate filaments that provide support and stability to muscle fibers. This recombinant form of desmin is often used in experiments to study its function and interactions with other proteins. Researchers can use this protein to gain insights into various cellular processes and mechanisms related to muscle development, contraction, and disease. Its high purity and quality make it an ideal choice for scientific investigations requiring reliable and consistent results.Degré de pureté :Min. 95%H-VINDFVEK^-OH
Peptide H-VINDFVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SDGPVKV^-OH
Peptide H-SDGPVKV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Apolipoprotein C-III [25-40]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-R^PPGFSP-OH
Peptide H-R^PPGFSP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SARS-CoV-2 Antigen Peptide NCAP (TWLTYTGAIKLDDKDPNF)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C97H144N22O30Masse moléculaire :2,098.43 g/molH-TKQTAR^^-OH
Peptide H-TKQTAR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SNRP70
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAc-PGP-OH
Peptide Ac-PGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Nesfatin-1 (Human)
Nesfatin-1 is a peptide hormone that is synthesized in the brain, pancreas, and gut. It can be found in human plasma and cerebrospinal fluid. Nesfatin-1 has been shown to decrease food intake through its effects on the hypothalamus. This peptide hormone also stimulates insulin secretion from pancreatic beta cells, which may be due to its ability to inhibit the release of glucagon. Nesfatin-1 has been shown to have a strong effect on glucose homeostasis and may be used as an adjunct therapy for diabetes mellitus type 2 patients who are resistant to metformin treatment.Formule :C427H691N113O134Degré de pureté :Min. 95%Masse moléculaire :9,551.95 g/molH-ILDFGLAR^-OH
Peptide H-ILDFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RGDY-NH2
Peptide Ac-RGDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAPEEHPVLLTEAPLNPK^-OH
Peptide H-VAPEEHPVLLTEAPLNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Aoa-KSKTKC-OH
Peptide Aoa-KSKTKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Degarelix acetate
CAS :Produit contrôléSynthetic peptide used in treatment of prostrate cancerFormule :C82H103ClN18O16(C2H4O2)xDegré de pureté :Min. 98 Area-%Couleur et forme :White/Off-White SolidMasse moléculaire :1,632.26 g/molAc-VGVAPG-NH2
Ac-VGVAPG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFmoc-PFAV
Peptide Fmoc-PFAV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-95/aa377 - 391
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,906.3 g/molH-IVGGWECEK^-OH
Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-NH2
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormule :C190H288N54O57Masse moléculaire :4,240.7 g/molH-HSQGTFTSDYSK^YLDSRRAQDFVQWLMNTKR^NRNNIA-OH
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormule :C192H295N61O60SMasse moléculaire :4,449.9 g/molH-NAVEVLKR^-OH
Peptide H-NAVEVLKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.gp100 (86-95)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
![Des-n-Octanoyl-[Ser3]-Ghrelin (Human, 1-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPGH-3646-PI.webp&w=3840&q=75)
![H-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPCI-3899-PI.webp&w=3840&q=75)
![Apolipoprotein C-III [25-40]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP51036.webp&w=3840&q=75)
