
Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30471 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Ac-CGPGLGEYMFDKETLSD-OH
<p>Peptide Ac-CGPGLGEYMFDKETLSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-ENPVVHFFKNIVTPR-OH
<p>Peptide LCBiot-ENPVVHFFKNIVTPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLLLSAALSAGK^-OH
<p>Peptide H-QLLLSAALSAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GKWERPFEVK^-OH
<p>Peptide H-GKWERPFEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GAD65 (206-220)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C86H129N15O24Masse moléculaire :1,757.07 g/molSIVmac239 - 111
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,695 g/molH-QQTVTLLPAADLDDFSK^-OH
<p>Peptide H-QQTVTLLPAADLDDFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cecropin A
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C136H233N33O29Masse moléculaire :2,794.55 g/molLCBiot-GTAG-OH
<p>Peptide LCBiot-GTAG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HGEGTFTSDLSKQMEEEAVRLF^IEWLKNGGPSSGAPPPS-NH2
<p>Peptide H-HGEGTFTSDLSKQMEEEAVRLF^IEWLKNGGPSSGAPPPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGPLDGTYR^-OH
<p>Peptide H-GGPLDGTYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Prostatic Acid Phosphatase (248 - 286), PAP (248 - 286)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C203H342N60O54S2Masse moléculaire :4,551.5 g/molLCBiot-SGVYKVAYDWQH-NH2
<p>Peptide LCBiot-SGVYKVAYDWQH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KFRKAFKRFF-NTPEGBiot
<p>Peptide H-KFRKAFKRFF-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YYTPVLAK^-OH
<p>Peptide H-YYTPVLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQTAPVPMPDLK^-OH
<p>Peptide H-LQTAPVPMPDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GP120 - W61D - 3
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,906.3 g/molH-PLIYLRLLRGQFC-NH2
<p>Peptide H-PLIYLRLLRGQFC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FQSVFTVTR^-OH
<p>Peptide H-FQSVFTVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-MRTPRCG-NH2
<p>Peptide Ac-MRTPRCG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5Fam-GDYSHCSPLRYYPWWKCTYPDPEGGG-NH2
<p>Peptide 5Fam-GDYSHCSPLRYYPWWKCTYPDPEGGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTVGAAQVPAQLLVGALR^-OH
<p>Peptide H-LTVGAAQVPAQLLVGALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRVYIHPFHL-NH2
<p>Peptide H-DRVYIHPFHL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MVTGVASALSSR^-OH
<p>Peptide H-MVTGVASALSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPPSEPSPLEAEFQR^-OH
<p>Peptide H-DPPSEPSPLEAEFQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>FMRF-like neuropeptide flp-11-2
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C54H92N20O14SMasse moléculaire :1,277.4 g/molH-IL^DTAGL^EEY-OH
<p>Peptide H-IL^DTAGL^EEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]-4-methylpentanoyl]am ino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]amino]-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C42H74N10O12SMasse moléculaire :943.18 g/molDynorphin A (1-17)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C99H155N31O23Masse moléculaire :2,147.5 g/molFmoc-MRWQEMGYIFYPRKLR-OH
<p>Peptide Fmoc-MRWQEMGYIFYPRKLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPEVDVLTK^-OH
<p>Peptide H-FPEVDVLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-VLDFAPPGA-OH
<p>Peptide LCBiot-VLDFAPPGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSKITHR^IHWESASLL-OH
<p>Peptide H-SSKITHR^IHWESASLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GTPase NRas (55-64)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Intermedin / Adrenomedullin-2 (Human) - I-125 Labeled
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-GIV^E-OH
<p>Peptide H-GIV^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLGEEYVK^^-OH
<p>Peptide H-YLGEEYVK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cyc-Biot-YCWSQYLCY-NH2
<p>Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNVEDAGGETLGR^^-OH
<p>Peptide H-VNVEDAGGETLGR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTFLGLQHWVPELAR^-OH
<p>Peptide H-VTFLGLQHWVPELAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>pE-RPRLSHKGPMPF-OH
<p>Peptide pE-RPRLSHKGPMPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Masse moléculaire :1,533.82 g/molLys-Asp-Cys
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C13H24N4O6S1Masse moléculaire :364.42 g/molAc-CETVSTQELYS-NH2
<p>Peptide Ac-CETVSTQELYS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>M 1145
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C128H205N37O32Masse moléculaire :2,774.26 g/molThr-Met-Ile
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C15H29N3O5S1Masse moléculaire :363.47 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
<p>Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-G^^G^^G-OH
<p>Peptide H-G^^G^^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-DIEVLQEQIRC-NH2
<p>Peptide Ac-DIEVLQEQIRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CETVFHRVSQDGLDL-NH2
<p>Peptide Ac-CETVFHRVSQDGLDL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GP120 - W61D - 16
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,678.9 g/mol
