Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
29633 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-IWLDNVR^-OH
Peptide H-IWLDNVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-97/aa385 - 399
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,724.1 g/molMotilin (human, porcine)
Peptide derived from the gastrointestinal hormone Motilin, secreted from endocrine cells in the small intestines, mainly from the jejunum and duodenum, in response to the fasting, drinking water or the mechanical stimulus of eating.Masse moléculaire :2,697.4 g/molGLP-1 (1-37)
CAS :Glucagon-like peptide (GLP) 1 is a post-translationally modified version of proglucagon. GLP-1 (1-37) is a naturally produced analog of GLP-1. Unlike truncated GLP-1, GLP-1 (1-37) does not alter food intake in rat models or pancreatic insulin secretion. GLP-1 (1-37) can induce insulin production in developing adult intestinal cells via upregulation of the ngn3 gene and its downstream targets. This can restore glucose homeostasis when implanted into diabetic mice. GLP-1 (1-37) may offer a future treatment for diabetes mellitus. GLP-1 (1-37) can also inhibit chemokine-induced migration of human CD4-positive lymphocytes, an early step in atherogenesis. This raises the possibility that GLP-1 (1-37) is part of a novel mechanism to modulate vascular disease.Masse moléculaire :4,169.54 g/molHyp-Gly dipeptide
A hydroxyproline glycine peptide in acid form. This peptide is a substrate for prolyl dipeptidase. Ingestion of the Hyp-Gly dipeptide can improve skin conditions. Hyp-Gly ingestion improves facial skin moisture and elasticity and reduces facial aging. Additionally, Hyp-Gly enhances fibroblast proliferation.Masse moléculaire :188.1 g/molGhrelin Rat, Mouse
Ghrelin is involved in several physiological processes, including feeding and lipid accumulation, stress response, anxiety, cardiac performance, immunity and inflammation, taste sensation, reward-seeking behaviour, regulation of glucose metabolism and thermogenesis, memory, motivation and learning.Ghrelin is a peptide hormone that typically has a serine at the third residue and relies on modification with a fatty acid to give ghrelin its functional activity. In its modified form, ghrelin is an endogenous ligand for the pituitary gland's growth hormone receptor (GHS-R) and stimulates growth hormone release. Rat/mouse ghrelin differs from the human form at positions 11 and 12 (RV) in rats to (KA) in humans.Ghrelin acts on the hypothalamic arcuate nucleus as an orexigenic agent to stimulate appetite. Ghrelin is produced in the stomach as a precursor peptide preproghrelin, cleaved to ghrelin. Ghrelin circulates in the blood and can cross the blood-brain barrier. Levels of ghrelin respond to fasting conditions and allow signals about the energy status to be transmitted from the peripheral organs to the central nervous system to maintain energy homeostasis.Ghrelin is a valuable target for treating conditions such as anorexia, cachexia, sarcopenia, cardiopathy, neurodegenerative disorders, renal and pulmonary disease, gastrointestinal disorders, inflammatory disorders and metabolic syndrome.Couleur et forme :PowderMasse moléculaire :3,314.8 g/molH-HEIPVLP^NR-OH
Peptide H-HEIPVLP^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 20 (VQHTYFTGSEVENVS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,696.8 g/molTransportan
Transportan is an amphipathic 27 amino acid peptide that was generated from 12 functional amino acids of galanin and 14 amino acids of mastoparan connected via a lysine residue. Transportan has been functionally characterised as a cell penetrating peptide (CPP) that does not appear to be mediated by endocytosis. All cell types tested were permeated by transportan, initially localising to the outer membrane it then travels to cytoplasmic membrane structures and eventually perfuses to the nucleoli. This CPP has been used for numerous applications and assays to great effect including indirect immunofluorescence and drug delivery.TP reveals some characteristic features of both galanin and mastoparan since it inhibits the binding of galanin to GALR-1 receptor as well as modulates the activity of G proteins due to the inhibition of GTPase activity.Couleur et forme :PowderMasse moléculaire :2,180.4 g/mol[5-FAM]-(RFR)4XB
(RXR)4XB is a cationic membrane-penetrating peptide and is effective in delivering phosphorodiamidate morpholino oligonucleotides (PMOs) into eukaryotic cells such as Escherichia coli. It contains 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.Masse moléculaire :2,396.3 g/molH-WLQGSQELPR^-OH
Peptide H-WLQGSQELPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QKSDDDYEDYASNKTC-NH2
Peptide H-QKSDDDYEDYASNKTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLNQTDETL^-OH
Peptide H-FLNQTDETL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SDGPVKV^-OH
Peptide H-SDGPVKV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Apolipoprotein C-III [25-40]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMART-1 (26-35)
CAS :Native Melan-A (26-35) decapeptide derives from the melanocyte lineage-specific protein Melan-A/MART-1, which is expressed in almost 75-100% of primary and metastatic melanomas. The region 26-35 of Melan-A protein acts as an antigenic peptide that is recognized by CD8+ tumor-reactive cytolytic T lymphocytes (CTLs) for designing antigen-specific cancer vaccines1. It has been shown that CD8+ Melan-A-specific CTLs isolated from melanoma patients efficiently lyse the Melan-A-expressing HLA-A*0201+ melanoma cell line. However, CTLs preferentially recognize the Melan-A (26-35) peptide as compared with the Melan-A (27-35) peptide. Moreover, the Melan-A (26-35) A27L analog (ELAGIGILTV) has a higher binding affinity to HLA-A*0201 than the native Melan-A (26-35) peptide (EAAGIGILTV), and consequently displays more potent antigenicity and immunogenicity. It has been reported that the concentration of Melan-A (26-35) A27L analog required to obtain 50% of maximal antigenic activity (EC50) is 0.01nM, whereas that of the native Melan-A (26-35) peptide is 0.25nM1. Therefore, the relative activity of Melan-A (26-35) A27L analog is 25 fold higher than that of the native Melan-A (26-35) peptide. Furthermore, functional competition assay has shown that the concentration of Melan-A (26-35) A27L analog required to achieve 50% inhibition (IC50) of tumor lysis is 2nM, which is 10 fold lower than that of the native Melan-A (26-35) peptide. Regarding peptide stability in human serum, the half-lifes (t1/2) of the native Melan-A (26-35) peptide and the A27L analog are quite similar (45 and 40min, respectively) as measured by HPLC-ESI-MS, but much higher than that of the Melan-A (27-35) nonapeptide (5min).Formule :C42H74N10O14Couleur et forme :PowderMasse moléculaire :943.1 g/molH-R^PPGFSP-OH
Peptide H-R^PPGFSP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PLSMVGPSQGR^SPSYAS-OH
Peptide H-PLSMVGPSQGR^SPSYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Natalizumab LC46-58 KGN deimmunised
Natalizumab LC46-58 KGN deimmunisedMasse moléculaire :1,452.8 g/molAsp-Glu-Pro-Pro-Gln-Ser-Pro-Trp-Asp-Arg
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C53H75N15O19Masse moléculaire :1,226.25 g/molBiotin-Influenza A NP (147-155) (H-2Kd)
Influenza A nucleoprotein (NP) residues 147-155 (TYQRTRALV) is from a conserved region of the nucleoprotein that is positively selected. NP (147-155) is an effective immunodominant CTL epitope MHC allele H-2Kd in mice that can induce an effective antigen-specific immunity. This was validated by HLA binding and cytotoxicity assays in human cells. Immunisation of mice with the NP (147-155) offers protection against a fatal dosage of influenza. In addition, the NP (147-155) epitope can stimulate antigen-specific T cells in T cell assays such as ELISPOT to understand humoral responses to viral infection. Further work with the NP (147-155) epitope can help new flu vaccine design to provide more effective protection. This epitope is provided with a C-terminal biotin sequence for easier purification and detection.Masse moléculaire :1,332.7 g/molH-IQPTTPSEPTAIK^-OH
Peptide H-IQPTTPSEPTAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-PEK-NH2
Peptide Ac-PEK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.JAG-1, scrambled
Scrambled peptide of JAG-1(188-204). Jagged - 1 is a cell surface ligand for in the Notch pathway. Notch receptors and ligands are present on the extracellular service of cells and require cell-cell contact for engagement. Ligand binding to Notch receptors results in the proteolytic cleavage of membrane-bound Notch receptors, thus allowing the intercellular region to be transported to the nucleus and become a transcriptional activator. The ligand-induced Notch activation is regulated by E3 ubiquitin ligases, Mindbomb1 (Mib-1) and Neuralized.JAG1 is widely expressed throughout mammalian development, across many tissues and developmental stages. Notch signalling plays a critical role in cellular fate determination including muscle cell differentiation, neurogenesis, and the development of the sensory regions of the inner ear- heart- kidney- eye- lung and other tissues.Jag-1 has been implicated in breast- cervical- colorectal- endometrial- gastric- head and neck- ovarian- hepatocellular- lung- pancreatic- prostate, and kidney and adrenocortical cancers, leukemia and lymphoma. Co-overexpression of Notch-1 and Jagged-1 predicts the poorest overall cancer survival. JAG1 mutations have also been associated Alagille syndrome.Masse moléculaire :2,105.9 g/molTruncated flagellin 22 (flg22)
Flagellin is the structural protein which forms the major portion of bacterial flagella filaments. The N- and C- terminals of flagellin are highly conserved regions, whereas the central core can vary greatly between bacterial species. Flagellin 22 (flg22) is the most conserved stretch of amino acids across bacterial species and is located towards the N-terminal of flagellin.Flg22 is a potent elicitor of plant immune responses and is recognised in plants by the membrane bound leucine-rich repeat-receptor kinase FLAGELLIN SENSITIVE 2 (FLS2). Flg22 induces defence gene expression to trigger both local and systemic immune responses and is thus widely used in plant defence studies.Truncated flagellin 22 (flg22-θ”2) represents amino acids 1-20 of flg22. It is a strong and selective agonist of tomato FLS2, with weak agonist activity towards Arabidopsis FLS2 even at high concentrations.Masse moléculaire :2,087.1 g/molAntennapedia peptide
Identification of cell penetrating conjugates has aided numerous areas of scientific development. The Drosophila transcription factor Antennapedia contains a homeodomain that can be internalised by cells to the cytoplasm and to the nucleus in a receptor-independent mechanism. The key residues for internalisation have been sequenced (RQIKIWFQNRRMKWKK), named penetratin, and used in several studies to aid entry of fusion proteins into cells.The full 60 amino acid homeodomain was fused to a T cell epitope of the influenza nucleoprotein and successfully internalised into T cells for presentation. The CPP, penetratin, was fused to a ligand for Grb-2 resulting in inhibition of downstream Grb-2 signalling events.- Penetratin has also been used in vivo to prime cytotoxic T lymphocytes by conjugating short antigenic peptides to the CPP. Penetratin is provided here as a C-terminal acid but is also available in amide form.Masse moléculaire :2,246.73 g/molSecretin (rat)
CAS :Secretin is a gastrointestinal hormone secreted by S cells in the small intestine, targeting G-protein coupled secretin receptors in numerous cell types. Secretin is synthesised from the preprohormone pro-secretin and is involved in regulating gastric acid and bicarbonate ion secretion in the duodenum and regulating water homeostasis. During glucose intake, secretin stimulates the pancreas to release insulin.Secretin has clinical relevance as a method to detect gastrin-producing tumours. Administration of exogenous secretin to the duodenum for secretin stimulation test to occur. Secretin can also be used to detect pancreatic insufficiencies via s administration during endoscopic retrograde cholangiopancreatography (ERCP). This allows the detection of inflammatory and neoplastic conditions of the pancreas.Secretin plays a different role in the central nervous system, such that in secretin deficient mice, synaptic plasticity and hippocampal synaptic activity are altered. Thus, secretin can be categorised as a neuropeptide.Formule :C129H216N42O42Masse moléculaire :3,027.36 g/molH-FPLTNAIK^-OH
Peptide H-FPLTNAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STDTAYMELSSLR^-OH
Peptide H-STDTAYMELSSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVL^VQREKDL^PNYNWNSFGL^RF-NH2
H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Formule :C258H401N79O78Masse moléculaire :5,857.5 g/molH-TANDLNLLILR^-OH
Peptide H-TANDLNLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HEAWITLEK^-OH
Peptide H-HEAWITLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Leptin (116-130) Mouse
Leptin is a member of the adipocytokines or adipokines group of cytokines which are primarily produced in adipose tissue. Leptin is both a hormone involved in multiple endocrine functions, bone metabolism and thermoregulation, and a cytokine that promotes inflammatory responses. People with obesity have elevated levels of leptin. This contributes to the state of low-grade inflammation that makes those individuals more likely to develop cardiovascular diseases, type II diabetes, degenerative disease and autoimmune disease. Reduced levels of leptin, found in malnourished individuals, has been linked to an increased risk of infection and reduced cell-mediated immunity.Leptin binds to leptin receptors (ObRs), of which there are at least six isoforms (ObRa, ObRb, ObRc, ObRd, ObRe, and ObRf). This fragment of leptin has been shown to restrict weight gain and food intake in female mice lacking active leptin.Couleur et forme :PowderMasse moléculaire :1,559.8 g/molClick MitP
MitP cell penetrating peptide labelled at the N-terminus with an alkyne attachment for ease of reaction with an opposite Click reactive partner (azide).Couleur et forme :PowderMasse moléculaire :1,601.1 g/molH-FFVPPFQQSPR^-OH
Peptide H-FFVPPFQQSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QFYDQALQQAVVDDDANNAK^-OH
Peptide H-QFYDQALQQAVVDDDANNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLPAPITR^-OH
Peptide H-DLPAPITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NFLINETAR^-OH
Peptide H-NFLINETAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLWEWASVR^-OH
Peptide H-YLWEWASVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SARS-CoV-2 NSP7 (6-20)
SARS-CoV-2 NSP7 is part of the RNA-dependent RNA polymerase heterotetramer for mediating coronavirus RNA synthesis. NSP7 and NSP8 form a channel to confer processivity on RNA polymerase. In addition, NSP7 aids in stabilising NSP12 regions involved in RNA binding and is essential for a highly active NSP12 polymerase complex. These factors make NSP7 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP7 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP7 (6-20) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.Masse moléculaire :1,629 g/molH-G^PSLFPLAPSSK^-OH
Peptide H-G^PSLFPLAPSSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLHPLEGAVVIIFK^-OH
Peptide H-VLHPLEGAVVIIFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSQVWLGR^-OH
Peptide H-NSQVWLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[5-FAM]-CRAMP (6-39)
Amino acids 6-39 of the cathelicidin-related anti-microbial peptide (CRAMP), the mouse homologue of the human LL-37 anti-microbial peptide.CRAMP possesses potent anti-bacterial activity against Gram-positive and Gram-negative bacterial strains with no haemolytic activity. As well as displaying direct anti-microbial activity, CRAMP also binds to lipopolysaccharide (LPS) to neutralise its activity.CRAMP is a cationic peptide, encoded for by the Camp gene and is highly expressed in bone marrow. Its expression is up-regulated by infectious and inflammatory signals and it is secreted by cells such as neutrophils epithelial cells and macrophages.This peptide contains N-terminal 5-Carboxyfluorescein (5-FAM), a widely used, green fluorescent tagMasse moléculaire :4,236.91 g/molCbz-D-Arg-Gly-Arg-pNA
Peptide Cbz-D-Arg-Gly-Arg-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPFPIIV^-OH
Peptide H-GPFPIIV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
BMAP-18 (truncated)
BMAP-27 is a member of the cathelicidin family and is a potent inhibitor of microbial growth, however at higher concentrations it is also cytotoxic to mammalian cells. BMAP-18 has rapid bactericidal activity against Staphylococcus aureus, Streptococcus uberis, and Escherichia coli.BMAP-18 has low toxicity to mammalian cells, insect cells and the tsetse bacterial symbiont Sodalis glossinidius while retaining an ability to kill a variety of species and life cycle stages of pathogenic kinetoplastid parasites including African trypanosomes, fish trypanosomes and Leishmania parasites. BMAP-18 also has immunomodulatory activity.Masse moléculaire :2,341.5 g/molH-GLQTSQDAR^-OH
Peptide H-GLQTSQDAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTIAALLSPYSYSTTAVVTNPK^E-OH
Peptide H-YTIAALLSPYSYSTTAVVTNPK^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![[5-FAM]-(RFR)4XB](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1101021.webp&w=3840&q=75)
![Apolipoprotein C-III [25-40]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP51036.webp&w=3840&q=75)
![[5-FAM]-CRAMP (6-39)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100256.webp&w=3840&q=75)
