Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29634 produits trouvés pour "Peptides"
CMVpp65 - 69 (RNGFTVLCPKNMIIK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,655.2 g/molH-RPPGFSPF^R-OH
Peptide H-RPPGFSPF^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Qpr-NH2
Peptide Ac-Qpr-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Phe-Ile-Arg-Gly-Gly-Met-Tyr-Glu-Gly-Lys-Lys-OH
H-Phe-Ile-Arg-Gly-Gly-Met-Tyr-Glu-Gly-Lys-Lys is a peptide that has biological activity. It is a member of the class of Biologically Active Peptides, which are biochemicals that have been shown to have cardioprotective effects. This peptide was found to reduce cardiac injury and dysfunction in animal models of myocardial infarction.
Formule :C58H92N16O15SDegré de pureté :Min. 95%Masse moléculaire :1,285.54 g/molH-S^LSLSPG-OH
Peptide H-S^LSLSPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TNQELQEINR^-OH
Peptide H-TNQELQEINR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MFL^SFPTTK-OH
Peptide H-MFL^SFPTTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.gp100 (457-466)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C47H85N13O15Masse moléculaire :1,072.28 g/molH-QFPILLDFK^-OH
Peptide H-QFPILLDFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-KYSEEGDGPAQHAEQC-NH2
Peptide Ac-KYSEEGDGPAQHAEQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Click (KFF)3K
(KFF)3K is a cationic cell penetrating peptide which can be conjugated to PNA oligomers to aid in their penetration of the bacterial cell wall to function as anti-microbials. (KFF)3K is labelled at the N-terminus with an alkyne attachment for ease of reaction with an opposite Click reactive partner (azide).
Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,491.8 g/molAc-KLTWQELYQLKYKGI-NH2
Peptide Ac-KLTWQELYQLKYKGI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-K^TTKS-OH
Peptide H-K^TTKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LYVTIPLGIK^-OH
Peptide H-LYVTIPLGIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^DSSWSETSEASYSGL-OH
Peptide H-R^DSSWSETSEASYSGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CDDYYYGFGCNKFGRPRDD-NH2
Peptide H-CDDYYYGFGCNKFGRPRDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyclo(Arg-Ala-Asp-D-Tyr-Lys)
Cyclo(Arg-Ala-Asp-D-Tyr-Lys) is a peptide macrocycle that has been shown to have potent anti-cancer activity. It binds to the receptor for epidermal growth factor (EGF), which is overexpressed in many cancers, and inhibits its function. Cyclo(Arg-Ala-Asp-D-Tyr-Lys) is also able to inhibit the production of nitric oxide by inhibiting the synthesis of arginase. This peptide has also been shown to induce apoptosis in cancer cells by altering the mitochondrial membrane potential and activating caspases 3 and 9.Formule :C28H43N9O8Degré de pureté :Min. 95%Masse moléculaire :633.70 g/molH-ALLFIPR^-OH
Peptide H-ALLFIPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAAQK^-OH
Peptide H-DAAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVLTIDK^K^-OH
Peptide H-AVLTIDK^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 73
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,861.1 g/molH-YDPSLKPLSVSYDQATSLR^-OH
Peptide H-YDPSLKPLSVSYDQATSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-VHWDFRQWWQPS-OH
Peptide LCBiot-VHWDFRQWWQPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPPYLFT-OMe
Peptide H-LPPYLFT-OMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILAGPAGDSNVVK^-OH
Peptide H-ILAGPAGDSNVVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TVLAVFGK^-OH
Peptide H-TVLAVFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-KPVSKMRMATPLLMQAL-OH
Peptide LCBiot-KPVSKMRMATPLLMQAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-DKFNHEAEDLFYQ-NH2
Peptide Ac-DKFNHEAEDLFYQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVTKYTSSK-NH2
Peptide H-AVTKYTSSK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-89/aa353 - 367
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,492.8 g/molH-GPGFTGGDILR^-OH
Peptide H-GPGFTGGDILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVEGAGSIAAATGFVK^-OH
Peptide H-TVEGAGSIAAATGFVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Asp-Glu-Asp-Glu
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C18H26N4O13Masse moléculaire :506.42 g/molFmoc-Pro-Gly-OH
CAS :Fmoc-Pro-Gly-OH is an antimicrobial agent that binds to bacterial cell walls and prevents the bacteria from assembling. It has a conformation that mimics the structure of thioether antibiotics, which are unilamellar and assembled. Fmoc-Pro-Gly-OH inhibits the pyrophosphate binding site, preventing the synthesis of ATP in bacteria. This drug also has affinity for alkene binders, which may be due to its structural similarity to these compounds.
Formule :C22H22N2O5Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :394.42 g/molH-ASDPSLK^-OH
Peptide H-ASDPSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EALAENNLNLPK^-OH
Peptide H-EALAENNLNLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FSLVGIGGQDLNEGNR^-OH
Peptide H-FSLVGIGGQDLNEGNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Histone H3 (1-20) K4Me3, K9Ac, pS10-GG-[Cys(AZ647)]
Histone H3 (1 - 20) K4Me3 is derived from Histone 3 (H3), which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Like the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing many lysine and arginine residues, they have a positive net charge which interacts electrostatically with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone-modifying enzymes which target histone proteins. Both processes alter the positioning of the nucleosome, allowing the DNA to be either available or inaccessible to the transcription machinery.Histone tails can undergo multiple modifications, including acetylation, methylation, ubiquitylation and sumoylation. The purpose of the modifications is believed to alter chromatin function/structure. Lysine 4 of Histone H3 (1 - 20) K4Me3 has been tri-methylated, lysine 9 has been acetylated, and serine 10 has been phosphorylated. This peptide is labelled with the Aurora Fluor 647 fluorescent tag.
Degré de pureté :Min. 95%Masse moléculaire :3,543.6 g/molH-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSDLIVLGLPWK^-OH
Peptide H-TSDLIVLGLPWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTFAQLSELHCDK^-OH
Peptide H-GTFAQLSELHCDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IIAPPERK^-OH
Peptide H-IIAPPERK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CMQNPYSRHSSMPRPDY-OH
Peptide Ac-CMQNPYSRHSSMPRPDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NIETIINTFHQYSVK^-OH
Peptide H-NIETIINTFHQYSVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-MSGRPRTTSFAES-NH2
Peptide Biot-MSGRPRTTSFAES-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GGLNDIFEAQKIEWHED-NH2
Peptide Ac-GGLNDIFEAQKIEWHED-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-EAQQHLLQLT-NH2
Peptide LCBiot-EAQQHLLQLT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELTIGSK^-OH
Peptide H-ELTIGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MDRTSASQQSNYGKC-NH2
Peptide H-MDRTSASQQSNYGKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MART-1 (26-35) (human)
CAS :Native Melan-A (26-35) decapeptide derives from the melanocyte lineage-specific protein Melan-A/MART-1, which is expressed in almost 75-100% of primary and metastatic melanomas. The region 26-35 of Melan-A protein acts as an antigenic peptide that is recognized by CD8+ tumor-reactive cytolytic T lymphocytes (CTLs) for designing antigen-specific cancer vaccines1. It has been shown that CD8+ Melan-A-specific CTLs isolated from melanoma patients efficiently lyse the Melan-A-expressing HLA-A*0201+ melanoma cell line. However, CTLs preferentially recognize the Melan-A (26-35) peptide as compared with the Melan-A (27-35) peptide. Moreover, the Melan-A (26-35) A27L analog (ELAGIGILTV) has a higher binding affinity to HLA-A*0201 than the native Melan-A (26-35) peptide (EAAGIGILTV), and consequently displays more potent antigenicity and immunogenicity. It has been reported that the concentration of Melan-A (26-35) A27L analog required to obtain 50% of maximal antigenic activity (EC50) is 0.01nM, whereas that of the native Melan-A (26-35) peptide is 0.25nM1. Therefore, the relative activity of Melan-A (26-35) A27L analog is 25 fold higher than that of the native Melan-A (26-35) peptide. Furthermore, functional competition assay has shown that the concentration of Melan-A (26-35) A27L analog required to achieve 50% inhibition (IC50) of tumor lysis is 2nM, which is 10 fold lower than that of the native Melan-A (26-35) peptide. Regarding peptide stability in human serum, the half-lifes (t1/2) of the native Melan-A (26-35) peptide and the A27L analog are quite similar (45 and 40min, respectively) as measured by HPLC-ESI-MS, but much higher than that of the Melan-A (27-35) nonapeptide (5min).Formule :C42H74N10O14Masse moléculaire :943.11 g/mol
![Histone H3 (1-20) K4Me3, K9Ac, pS10-GG-[Cys(AZ647)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1101681.webp&w=3840&q=75)
