Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29695 produits trouvés pour "Peptides"
beta-Amyloid/A4 Protein Precusor (APP) (319-335)
Catalogue peptide; min. 95% purity
Formule :C86H151N31O26S2Masse moléculaire :2,099.48 g/mol[Trp11] Neurotensin (8-13)
Catalogue peptide; min. 95% purity
Formule :C40H65N13O7Masse moléculaire :840.05 g/molBiotin-Glucagon (1-29), bovine, human, porcine
Catalogue peptide; min. 95% purity
Formule :C163H239N45O51S2Masse moléculaire :3,709.03 g/molBiotin-(Cys1,Lys(biotinyl)18)-Calcitonin (human)
Catalogue peptide; min. 95% purity
Formule :C171H254N4O16Masse moléculaire :3,870.52 g/molpp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
Catalogue peptide; min. 95% purity
Formule :C66H109N23O23Masse moléculaire :1,592.74 g/molAngiotensin II type 1 receptor (181-187), AT1, ATE.
Catalogue peptide; min. 95% purity
Formule :C40H52N10O13Masse moléculaire :880.92 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H357N71O67SMasse moléculaire :5,040.74 g/mol[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formule :C216H343N67O60Masse moléculaire :4,838.43 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS :Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C45H47FN6O14Degré de pureté :Min. 95%Masse moléculaire :914.89 g/mol[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Formule :C145H210N42O45Masse moléculaire :3,261.54 g/molInfluenza HA (529-537)
Catalogue peptide; min. 95% purity
Formule :C41H67N9O13Masse moléculaire :894.04 g/molSialokinin - 2
Catalogue peptide; min. 95% purity
Formule :C51H76N12O16SMasse moléculaire :1,145.31 g/molbeta-Lipotropin (61-64)
Catalogue peptide; min. 95% purity
Formule :C22H26N4O6Masse moléculaire :442.48 g/molH-D-Phe-pip-Arg-pna acetate
CAS :H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Formule :C27H36N8O5Degré de pureté :Min. 95%Masse moléculaire :552.6 g/molRef: 3D-QEA38896
Produit arrêtéKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Formule :C34H50N8O6SMasse moléculaire :698.9 g/molCaspase 1 Substrate 1m (ICE), fluorogenic
Catalogue peptide; min. 95% purity
Formule :C35H41N5O12Masse moléculaire :723.7 g/molAKT/PKB/Rac-Protein Kinase Substrate
Catalogue peptide; min. 95% purity
Formule :C74H114N28O20Masse moléculaire :1,715.91 g/mol[Phe22] Big Endothelin-1 (19-37), human
Catalogue peptide; min. 95% purity
Formule :C104H152N26O26Masse moléculaire :2,182.53 g/molIntermedin (rat)
Catalogue peptide; min. 95% purity
Formule :C226H361N75O64S2Masse moléculaire :5,216.99 g/molα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Formule :C93H136N22O27Masse moléculaire :1,994.25 g/molSH2 Domain Ligand (4)
Catalogue peptide; min. 95% purity
Formule :C40H51N5O18P2Masse moléculaire :951.86 g/mol[Pro34]-Neuropeptide Y, human, rat
Catalogue peptide; min. 95% purity
Formule :C189H285N55O57SMasse moléculaire :4,271.67 g/molbeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Formule :C170H253N47O52Masse moléculaire :3,787.20 g/molAGRP (25-51)
Catalogue peptide; min. 95% purity
Formule :C130H221N37O35SMasse moléculaire :2,894.43 g/mol[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
Catalogue peptide; min. 95% purity
Formule :C157H253N53O42Masse moléculaire :3,555.01 g/mol[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formule :C49H81N21O17Masse moléculaire :1,236.32 g/molHistone H3 (116-136), N15-39
Catalogue peptide; min. 95% purity
Formule :C112H197N39O30Masse moléculaire :2,570 g/molGnT-V (nt38-67)
Catalogue peptide; min. 95% purity
Formule :C54H89N13O13SMasse moléculaire :1,159.45 g/molKinase Domain of Insulin Receptor (5)
Catalogue peptide; min. 95% purity
Formule :C72H110N19O33Masse moléculaire :1,862.77 g/molDesmopressin
CAS :Produit contrôléDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formule :C46H64N14O12S2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,069.22 g/molgp100 (570-579)
Catalogue peptide; min. 95% purity
Formule :C41H71N11O17Masse moléculaire :990.09 g/mol[Cys(Acm)20,31]-EGF (20-31)
Catalogue peptide; min. 95% purity
Formule :C63H98N16O23S3Masse moléculaire :1,543.77 g/molFluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS :Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C41H43FN4O14Degré de pureté :Min. 95%Masse moléculaire :834.8 g/molBiotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Formule :C145H238N48O38S2Masse moléculaire :3,325.86 g/molP62 (417-429), M. leprae
Catalogue peptide; min. 95% purity
Formule :C65H116N16O17Masse moléculaire :1,393.75 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS :H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Formule :C28H53N7O8Degré de pureté :Min. 95%Masse moléculaire :615.76 g/molCerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molH-GILGFVFTL-OH
CAS :FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formule :C49H75N9O11Masse moléculaire :966.18 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molAngiotensin A (1-7) trifluoroacetate
CAS :Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/mol
![[Trp11] Neurotensin (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00688.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
![[Pro34]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00912.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00488.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
