Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29699 produits trouvés pour "Peptides"
Amyloid beta-Protein (6-20)
Catalogue peptide; min. 95% purity
Formule :C86H119N23O23Masse moléculaire :1,843.05 g/molbeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Formule :C28H45N7O9Masse moléculaire :623.71 g/molFMRF-related peptide, Lymnaea heptapeptide
Catalogue peptide; min. 95% purity
Formule :C41H59N11O9Masse moléculaire :850.00 g/molLys-(Tyr8)-Bradykinin
Catalogue peptide; min. 95% purity
Formule :C56H85N17O13Masse moléculaire :1,204.41 g/molFmoc-Phe-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Insulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Formule :C72H107N19O24Masse moléculaire :1,622.77 g/molbeta-Amyloid (10-35)
Catalogue peptide; min. 95% purity
Formule :C133H204N34O37SMasse moléculaire :2,903.38 g/mol[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Formule :C93H159N35O25Masse moléculaire :2,167.52 g/molAmylin (human) trifluoroacetate salt
CAS :Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.
Formule :C165H261N51O55S2Degré de pureté :Min. 95%Masse moléculaire :3,903.28 g/molDisulfide biotin azide
CAS :Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.Formule :C27H48N8O7S3Degré de pureté :Min 95%Masse moléculaire :692.92 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H357N71O67SMasse moléculaire :5,040.74 g/molDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Formule :C35H60N12O7Masse moléculaire :760.94 g/molTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Formule :C79H120N18O21Masse moléculaire :1,657.95 g/molSomatostatin-28 (1-14)
Catalogue peptide; min. 95% purity
Formule :C61H105N23O21SMasse moléculaire :1,528.72 g/mol[Ile34]-beta-Amyloid (25-34)
Catalogue peptide; min. 95% purity
Formule :C40H72N12O13Masse moléculaire :929.09 g/molAKT/PKB/Rac-Protein Kinase Substrate
Catalogue peptide; min. 95% purity
Formule :C74H114N28O20Masse moléculaire :1,715.91 g/molgp120, HIV-1 MN
Catalogue peptide; min. 95% purity
Formule :C135H221N45O33Masse moléculaire :3,002.55 g/molTGF α(34-43) (rat)
Catalogue peptide; min. 95% purity
Formule :C44H67N15O13S2Masse moléculaire :1,078.25 g/molKinase Domain of Insulin Receptor (5)
Catalogue peptide; min. 95% purity
Formule :C72H110N19O33Masse moléculaire :1,862.77 g/molDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Formule :C60H105N21O12Masse moléculaire :1,312.64 g/molDok-4 (263-275)
Catalogue peptide; min. 95% purity
Formule :C70H101N21O18Masse moléculaire :1,524.72 g/mol[Ala2] Met-Enkephalin, amide
Catalogue peptide; min. 95% purity
Formule :C28H38N6O6SMasse moléculaire :586.72 g/mol[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formule :C216H343N67O60Masse moléculaire :4,838.43 g/molDok-6 (263-275)
Catalogue peptide; min. 95% purity
Formule :C76H113N25O18Masse moléculaire :1,664.90 g/molH-Thr-Asp-OH TFA salt
CAS :Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C8H14N2O6C2F3HO2Degré de pureté :Min. 95%Masse moléculaire :348.23 g/molBiotinyl-MCH (salmon)
Catalogue peptide; min. 95% purity
Formule :C99H153N29O26S5Masse moléculaire :2,325.82 g/molBiotin-ACTH (1-39), human
Catalogue peptide; min. 95% purity
Formule :C217H322N58O60SMasse moléculaire :4,767.47 g/molParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Formule :C151H211N37O39SMasse moléculaire :3,199.65 g/mol[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Formule :C145H210N42O45Masse moléculaire :3,261.54 g/molVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Formule :C116H161N27O32S4Masse moléculaire :2,573.99 g/molSH2 Domain Ligand (4)
Catalogue peptide; min. 95% purity
Formule :C40H51N5O18P2Masse moléculaire :951.86 g/molHead activator
Catalogue peptide; min. 95% purity
Formule :C54H84N12O14Masse moléculaire :1,125.36 g/molP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Formule :C33H45N6O12PMasse moléculaire :748.8 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS :Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C33H36N2O9Degré de pureté :Min. 95%Masse moléculaire :604.65 g/molEndokinin A/B
Catalogue peptide; min. 95% purity
Formule :C50H77N13O12SMasse moléculaire :1,084.32 g/molZ-Ile-Trp-OH
CAS :Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C25H29N3O5Degré de pureté :Min. 95%Masse moléculaire :451.51 g/mol[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
Catalogue peptide; min. 95% purity
Formule :C157H253N53O42Masse moléculaire :3,555.01 g/molBiotin-Glucagon (1-29), bovine, human, porcine
Catalogue peptide; min. 95% purity
Formule :C163H239N45O51S2Masse moléculaire :3,709.03 g/molSynaptobrevin-2 (75-78) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formule :C23H33N5O9Masse moléculaire :523.55 g/mol[Pyr11]-Amyloid beta-Protein (11-40)
Catalogue peptide; min. 95% purity
Formule :C143H226N38O39SMasse moléculaire :3,133.71 g/molAGRP (25-51)
Catalogue peptide; min. 95% purity
Formule :C130H221N37O35SMasse moléculaire :2,894.43 g/molAdrenomedullin (1-52), porcine
Catalogue peptide; min. 95% purity
Formule :C262H403N79O76S3Masse moléculaire :5,971.67 g/mol[Phe22] Big Endothelin-1 (19-37), human
Catalogue peptide; min. 95% purity
Formule :C104H152N26O26Masse moléculaire :2,182.53 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molAngiotensin A (1-7) trifluoroacetate
CAS :Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molCerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molH-GILGFVFTL-OH
CAS :FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formule :C49H75N9O11Masse moléculaire :966.18 g/molCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/mol
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![[Ile34]-beta-Amyloid (25-34)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00451.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
![[Glu2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00171.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00488.webp&w=3840&q=75)
![[Pyr11]-Amyloid beta-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
