CymitQuimica logo
Peptides

Peptides

Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.

Sous-catégories appartenant à la catégorie "Peptides"

29609 produits trouvés pour "Peptides"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • H-ESLSSYWESAK^-OH


    Peptide H-ESLSSYWESAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43297

    ne
    À demander
  • β-Amyloid (37-43)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C27H49N7O9
    Masse moléculaire :615.73 g/mol

    Ref: 3D-PP50020

    ne
    À demander
  • H-LTPQAFSHFTFER^-OH


    Peptide H-LTPQAFSHFTFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46571

    ne
    À demander
  • nef peptide [Human immunodeficiency virus type 1] (73-82) acetyl/amide


    Nef is an accessory protein highly conserved amongst all primate lentiviruses, it is essential for viral replication in vivo- it is expressed by human immunodeficiency virus (HIV) HIV-1 and HIV-2.-Nef acts as a downregulator of class I human leukocyte antigens (HLA) expression in HIV-infected cells to help circumvent the immune response, such as Cytotoxic T lymphocytes (CTL) activity. An intact-nef-gene is critical for high viral loads, linked to development of acquired immunodeficiency syndrome (AIDS). Certain alleles of HLA have been associated with maintaining a seronegative status such as HLA-A*1101. This nef peptide sequence (73-82) has highly conserved residues, a study crystalised it bound within HLA-A*1101. Further investigation using this peptide sequence, with the attached acetyl group for added stability, could elucidate the nature of resistance to HIV infection and the nef residues.
    Masse moléculaire :1,272.7 g/mol

    Ref: 3D-CRB1001223

    500µg
    206,00€
    1mg
    282,00€
  • H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2


    Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).

    Ref: 3D-PP41946

    ne
    À demander
  • H-LNIPTDVLK^-OH


    Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42147

    ne
    À demander
  • H-ARTKQTARKSTGGKA-NH2


    Peptide H-ARTKQTARKSTGGKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44733

    ne
    À demander
  • Fas blocking peptide


    Blocks Fas-FasL interaction, and in the Neuro2a cell model of ischemia protects against ischemic stroke-induced neuronal cell death by binding to Fas expressing cells and rescuing them from Fas mediated apoptosis.
    Masse moléculaire :1,078.4 g/mol

    Ref: 3D-CRB1001538

    500µg
    206,00€
    1mg
    282,00€
  • EBV EBNA3C (258-266) (HLA-B27)


    Portion of EBV EBNA 3C
    Masse moléculaire :1,189.7 g/mol

    Ref: 3D-CRB1001465

    500µg
    206,00€
    1mg
    282,00€
  • CMVpp65 - 53 (ENTRATKMQVIGDQY)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,754 g/mol

    Ref: 3D-PP50883

    ne
    À demander
  • Compstatin


    The cyclic tridecapeptide Compstatin, binds to and selectively inhibits the interaction between C3 and convertase, hence preventing the formation of C3a and C3b and activation of the complement system. Compstatin has the ability to form β-turns and hydrophobic clusters which are crucial for its inhibitory properties. When binding between C3 MG4 and MG5 domains, located within the MG-ring of the β-chain, Compstatin undergos a conformational change which is believed to prevent C3 from binding to C3 convertase through steric hindrance. Consequently the complement cascade is inhibited.The complement cascade is an important feature of the immune system. C3b, produced from the interaction of C3 and C3 convertase, binds to pathogens and somatic cells and signals for their removal from the body. However the increased activation of the complement system can result in diseases, associated with Alzheimers, strokes, heart attacks and autoimmune diseases. Therefore Compstatin can be used as a therapeutic agent within medicine.
    Couleur et forme :Powder
    Masse moléculaire :1,549.7 g/mol

    Ref: 3D-CRB1000988

    500µg
    282,00€
    1mg
    386,00€
  • Ala-Asp-Ser-Asp-Pro-Arg

    CAS :
    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C25H41N9O12
    Masse moléculaire :659.65 g/mol

    Ref: 3D-PP50686

    ne
    À demander
  • CBL-B (239-247) Light


    CBL-B (239-247) Light.
    Masse moléculaire :1,215.7 g/mol

    Ref: 3D-CRB1000946

    25nMol
    206,00€
  • Neuropeptide S human


    Neuropeptide S (NPS) is a neuropeptide found in mammalian brains, primarily in neurons in the lateral parabrachial nucleus, the peri-locus coeruleus and the principle sensory 5 nucleus of the trigeminus. NPS in involved in several neuroendocrine, behavioural and inflammatory responses, including: reducing anxiety in mice- suppressing appetite and inducing wakefulness and hyperactivity. NPS treatment can be used to improve fear extinction in mice and limit fear memory retrieval after fear reduction training, thus making it an interesting target for treatment of post-traumatic stress disorder. NPS exerts its actions by binding to a G-protein coupled receptor, NPSR.
    Masse moléculaire :2,186.1 g/mol

    Ref: 3D-CRB1000500

    500µg
    206,00€
    1mg
    282,00€
  • survivin (baculoviral IAP repeat-containing protein 5) (21-28)


    Survivin is an intracellular tumour-associated antigen that is part of the inhibitor of apoptosis (IAP) family. Survivin expression increases as cells age but becomes over-expressed in cancer cells. Expression is also important during embryonic development and tissue regeneration. With roles in aging, apoptosis, and cancer, there is considerable interest in understanding the function of Survivin. Survivin expression is regulated by TGF-β and increased following intestinal inflammation during the healing process.The high expression of Survivin in cancer cells has led to the search for a vaccine that induces epitope-specific CD8+ T cells. The epitope TFKNWPFL restricted to H-2 Db was identified using prediction algorithms and MHC class I binding assays. The epitope was delivered to mice by intradermal electroporation (EP). The Survivin epitope induced a  CD8+ cytotoxic T lymphocyte (CTL) response as shown by IFN-staining- they also showed an activated effector phenotype as CD44 and CD107 were upregulated. The Survivin vaccine was able to confer protection against melanoma in mice and suppress angiogenesis. This Survivin epitope could be a vital step in creating a human vaccine that generates CD8 CTLs with specific functional cytotoxic activity against tumour cells.The sequence provided here aligns to residues 21-28 of the Survivin epitope, the initial residue of the epitope has been omitted as it is not conserved between mice and human sequences.
    Masse moléculaire :1,051.5 g/mol

    Ref: 3D-CRB1001241

    500µg
    206,00€
    1mg
    282,00€
  • C7


    Selective peptide ligand for FRalpha, demonstrating specific binding to FRalpha expression cells and tumour targeting ability in vivo.
    Masse moléculaire :1,374.7 g/mol

    Ref: 3D-CRB1001181

    500µg
    206,00€
    1mg
    282,00€
  • M12 muscle-homing peptide


    Gene therapy is potentially an ideal treatment for muscle tissue myopathies but targeting remains an issue. The large volume of muscle in the body versus the requirement for tissue-specificity is of particular concern. This heptapeptide has been shown to preferentially bind myofibers and thus can be used to study targeting of peptide/gene- delivery to muscle tissue. Research into gene therapy of Duchenne muscular dystrophy (DMD) and Spinal muscular atrophy (SMA) has been of particular interest with muscle targeting peptides.- This product has been shown to orientate to muscle and heart tissue and when conjugated to a phosphorodiamidate morpholino oligomer (PMO)-increases dystrophin expression by 25%. This product already shows ideal placement to continue cardiac research to overcome some of these issues.
    Couleur et forme :Powder
    Masse moléculaire :1,416.8 g/mol

    Ref: 3D-CRB1001635

    500µg
    206,00€
    1mg
    282,00€
  • SARS-CoV-2 ORF7a-10 (69-86)


    ORF7a is an accessory protein that is key to SARS-CoV-2 evading the immune system. ORF7a acts on the secretory pathway to lower surface MHC-I expression by specifically interacting with the MHC-I heavy chain and delaying its export from the endoplasmic reticulum. These factors make the ORF6 protein a viable target for developing new antiviral drugs. In addition, the identification of epitopes within the ORF7a-10 protein sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. ORF7a-10 protein (69-86) is an epitope candidate with various predicted HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.
    Masse moléculaire :2,052.2 g/mol

    Ref: 3D-CRB1001840

    500µg
    206,00€
    1mg
    282,00€
  • Histone H3 (1-22) K9Me1-Biotin


    Histone H3 (1-22) K9Me1-Biotin is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.Another modification process histones can undergo is biotinylation where the covalent attachment of a biotin molecule is catalysed by the enzyme Biotinidase. This cleaves biocytin to generate a biotinyl-thiester intermediate. The biotinyl can then be transferred onto the histone lysine ɛ-amino group which in this case it is covalently attached to Histone 3. Overall the biotinylation sites identified in histone 3 are: K4, K9 and K18. The presence of biotinylated histones have been detected in human cells such as lymphocytes and lymphomas.
    Couleur et forme :Powder
    Masse moléculaire :2,823.7 g/mol

    Ref: 3D-CRB1000483

    500µg
    386,00€
    1mg
    470,00€
  • BDC2.5 mimotope 1040-51


    BDC2.5 mimotope 1040-51 is a mimotope of BDC2.5 T cells which can recognise glutamic acid decarboxylase epitopes.
    Couleur et forme :Powder
    Masse moléculaire :1,297.7 g/mol

    Ref: 3D-CRB1001402

    500µg
    206,00€
    1mg
    282,00€
  • LCBiot-EDIIRNIARHLAQVGDSMDR-OH


    Peptide LCBiot-EDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43502

    ne
    À demander
  • H-ARTKQTARKSTGGKAPRKQLA-NH2


    Peptide H-ARTKQTARKSTGGKAPRKQLA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48598

    ne
    À demander
  • HXB2 gag NO-56/aa221 - 235


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,567.8 g/mol

    Ref: 3D-PP50097

    ne
    À demander
  • Ac-DPKSAAQNSKPRLSFSTKC-NH2


    Peptide Ac-DPKSAAQNSKPRLSFSTKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44437

    ne
    À demander
  • HyNic-GLFHAIAHFIHGGWHGLIHGWYG-OH


    Peptide HyNic-GLFHAIAHFIHGGWHGLIHGWYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45367

    ne
    À demander
  • H-LLIYY^TSR^-OH


    Peptide H-LLIYY^TSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49644

    ne
    À demander
  • H-GDLGIEIPAEK^-OH


    Peptide H-GDLGIEIPAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46994

    ne
    À demander
  • Jelleine I


    Jelleines are a family of very small (8-9 amino acid residues long) host defence peptides (HDPs) isolated from the royal jelly of honey bees (Apis mellifera). Jelleines do not present any similarity with other HDPs from other honeybees and are produced by the workers and secreted into Royal Jelly and provide abroad-spectrum protection of the bee hive against microbial infections. The Jelleines are not considered cytolytic or directly involved with inflammatory effects.Jelleine-I may be produced by tryptic digestion of MRJP-1 (produced in the hypopharyngeal glands of the worker honeybee and secreted into the royal jelly), followed by an exoproteinase action on N-terminal of the tryptic fragment. Jelleine-I is only 953.24-Da and exhibits excellent anti-microbial activity against both gram positive and gram negative bacteria and fungi. Jelleine-I increases the production of cellular ROS and binds with genomic DNA, which may contribute to its anti-fungal activity.PLEASE NOTE that in several published articles the sequence of Jelleine-I has been printed as PFKLSLHL -NH2, due to a mistake in the original reference: Fontana et al., (2004). The correct sequence, is PFKISIHL-NH2.

    Masse moléculaire :952.6 g/mol

    Ref: 3D-CRB1001557

    500µg
    206,00€
    1mg
    282,00€
  • H-DVINEAWFPEDQR^-OH


    Peptide H-DVINEAWFPEDQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41113

    ne
    À demander
  • LLO (91 - 99)

    CAS :
    LLO (91 - 99)
    Formule :C47H67N11O17
    Masse moléculaire :1,058.1 g/mol

    Ref: 3D-CRB1000725

    500µg
    206,00€
    1mg
    282,00€
  • H-ITLYLK^-OH


    Peptide H-ITLYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45690

    ne
    À demander
  • β-Amyloid (1-38)

    CAS :

    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C184H277N51O56S
    Masse moléculaire :4,131.6 g/mol

    Ref: 3D-PP50622

    ne
    À demander
  • Infliximab Heavy chain (46-60)


    Infliximab is a biologic medicine used in the treatment of numerous autoimmune diseases including Crohn disease, rheumatoid arthritis, and ankylosing spondylitis. Infliximab binds with high affinity to tumour necrosis factor-α (TNF-α) blocking most of the cytokine effects, which includes mediating the inflammatory responses. Infliximab is a chimeric human-mouse IgG monoclonal antibody- the constant regions of the heavy and light chains are human-derived. The heavy chain peptide (46-60) has been identified as an antigen for antigen-specific T cell analysis. Numerous methods of immunological analysis can be applied to this peptide to hopefully provide further insight to these autoimmune conditions.
    Masse moléculaire :1,689.9 g/mol

    Ref: 3D-CRB1001519

    500µg
    206,00€
    1mg
    282,00€
  • Ac-VAAWTLKAAA-NH2


    Peptide Ac-VAAWTLKAAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48367

    ne
    À demander
  • Biot-ERGVT-OH


    Peptide Biot-ERGVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46554

    ne
    À demander
  • H-IIPGGIYDADLNDEWVQR^-OH


    Peptide H-IIPGGIYDADLNDEWVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41205

    ne
    À demander
  • H-GSSDVDQLGK^-OH


    Peptide H-GSSDVDQLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49696

    ne
    À demander
  • Glucagon (1-29)-[Cys(Cy5)]


    Glucagon (1-29)-[Cys(Cy5)] is derived from glucagon, which is a peptide hormone secreted by alpha cells located in the islet of Langerhans region of the pancreas. Glucagon is an essential catabolic hormone that is responsible for the regulation of blood glucose levels. Once released into the bloodstream, glucagon stimulates the production of hepatic glucose, which means it is considered to be a glucose-mobilizing agent. Excessive levels of glucagon can result in the development of hyperglycaemia, since the action of glucagon results in abnormally high blood glucose levels.This peptide contains Cyanine 5 (Cy5), which is a widely used red fluorescent dye.
    Masse moléculaire :4,189 g/mol

    Ref: 3D-CRB1130431

    100µg
    386,00€
    500µg
    470,00€
  • HXB2 gag NO-67


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Masse moléculaire :1,803.2 g/mol

    Ref: 3D-PP51027

    ne
    À demander
  • H-PLSMVGPSQGR^SPSYAS-OH


    Peptide H-PLSMVGPSQGR^SPSYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40663

    ne
    À demander
  • Dystrophin (2765-2777)


    Forms of inherited muscular dystrophy such as Duchenne muscular dystrophy (DMD) and Becker muscular dystrophy (BMD) result from mutations targeting the dystrophin gene. These disorders are X-linked, progressive, and cause the gradual weakening of the muscles leading to respiratory failure and ultimately reduces the patient lifespan.In DMD, mutations lead to the production of premature stop codons and hence the truncated dystrophin protein product is vulnerable to nonsense mediated decay and degradation. Therefore, dystrophin production in muscle cells is reduced. On the other hand, nonsense mutations which also contribute to DMD, cause exon skipping in BMD and result in an internally truncated protein product which are partially functional. The symptoms of BMD are later onset compared with DMD which develop in patients between 2 to 7 years.Treatments of dystrophin disorders are in clinical trial including antisense oligonucleotide exon skipping and gene therapy. However, the efficacies of these treatments are not easily quantified. Currently levels of muscular dystrophin are quantified by western blot which can be unreliable. The peptide provided here, aligning residues dystrophin (2690-2700), has been tested via mass spectrometry to provide a more reliable method of validation of dystrophin levels. Further study with this dystrophin fragment could prove to be a vital step in the understanding and treatment of dystrophin disorders. Within our catalogue we also have other peptides tested for dystrophin quantification available plus the full-length dystrophin protein.
    Masse moléculaire :1,401.7 g/mol

    Ref: 3D-CRB1001662

    500µg
    206,00€
    1mg
    282,00€
  • Asp-Glu-Pro-Pro-Gln-Ser-Pro-Trp-Asp-Arg


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C53H75N15O19
    Masse moléculaire :1,226.25 g/mol

    Ref: 3D-PP50775

    ne
    À demander
  • Bombesin


    Bombesin was originally isolated from the skin of the european fire-bellied toad (Bombina bombina) and has two known homologues Neuromedin B (NMB) and gastrin-releasing peptide (GRP).Bombesin-like peptides are involved in many physiological functions including: regulation of food intake- anxiety and fear-related behaviour, thermoregulation, stress response, learning and memory and in the stimulation of smooth muscle contraction. Bombesin is also a tumour marker for small cell carcinoma in the lung, gastric cancer, pancreatic cancer, and neuroblastoma.The receptors for these two peptides are known as bombesin receptor type 1 (BB1 also known as NMB receptor) and bombesin receptor type 2 (BB2 also known as GRP receptor). Bombesin shows high affinity to both of these receptor subtypes. These bombesin-like peptides and their receptors are widely distributed in the central nervous system (CNS) and gastrointestinal (GI) tract.This peptide contains an N-terminal pyroglutamyl to prevent the intramolecular cyclisation of the N-terminal of glutamine to N-pyroglutamate (pGlu).
    Masse moléculaire :1,618.8 g/mol

    Ref: 3D-CRB1000583

    500µg
    206,00€
    1mg
    282,00€
  • H-IQPTTPSEPTAIK^-OH


    Peptide H-IQPTTPSEPTAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47451

    ne
    À demander
  • Ac-PEK-NH2


    Peptide Ac-PEK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43870

    ne
    À demander
  • EC dipeptide


    EC-acid has a formal charge of 0 and a range of biological and chemical uses. CE-acid is also available in our catalogue.
    Masse moléculaire :250.1 g/mol

    Ref: 3D-CRB1001692

    500µg
    206,00€
    1mg
    282,00€
  • Flagellin 22 (flg22)


    Flagellin is a structural protein which forms the major portion of bacterial flagellar filaments. The N- and C-terminals of flagellin are highly conserved regions, whereas the central core can vary greatly between bacterial species. Flagellin 22 (flg22) is the stretch of amino acids most conserved across bacterial species and is located towards the N-terminal of the flagellin protein.Flg22 is a potent elicitor of plant immune responses and is recognised in plants by the membrane bound leucine-rich repeat-receptor kinase FLAGELLIN SENSITIVE 2 (FLS2). Flg22 induces defence gene expression to trigger both local and systemic immune responses and is thus widely used in plant defence studies.
    Couleur et forme :Powder
    Masse moléculaire :2,272.48 g/mol

    Ref: 3D-CRB1000331

    500µg
    206,00€
    1mg
    282,00€
    5mg
    891,00€
    10mg
    1.518,00€
  • Ac-GCRDGPQGIAGQDRCG-OH


    Peptide Ac-GCRDGPQGIAGQDRCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46251

    ne
    À demander
  • AF12198


    AF12198 is a selective receptor antagonist to the human cytokine, type 1 interleukin-1 (IL-1) and thus blocks IL-1β signalling. AF12198 can inhibit IL-1-induced IL-8 production by human dermal fibroblasts and IL-1-induced intercellular adhesion molecule-1 (ICAM-1) expression by endothelial cells. AF12198 also blocks IL-1 induction of IL-6 and down regulates IL-6 induction in monkeys. AF12198 does not bind the human type II IL-1 receptor, or the murine type I IL-1 receptor.IL-1 influences a wide range of immune and inflammatory responses. Sustained expression of even low levels of IL-1 can be harmful in chronic inflammatory diseases such as rheumatoid arthritis and inflammatory bowel disease.
    Masse moléculaire :1,895.9 g/mol

    Ref: 3D-CRB1001289

    500µg
    386,00€
    1mg
    470,00€
    5mg
    942,00€
    10mg
    1.211,00€
  • GP120 - W61D - 120


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Masse moléculaire :1,784 g/mol

    Ref: 3D-PP50189

    ne
    À demander