CymitQuimica logo
Peptides

Peptides

Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.

Sous-catégories appartenant à la catégorie "Peptides"

29610 produits trouvés pour "Peptides"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • H-TPVITGAPYEYR^-OH


    Peptide H-TPVITGAPYEYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43147

    ne
    À demander
  • H-LTILDQSEAPVR^-OH


    Peptide H-LTILDQSEAPVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45216

    ne
    À demander
  • H-His(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB


    H-His(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin that is used in the synthesis of peptides. It is a building block for synthesizing peptides and proteins. H-His(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB is also used as an alcohol for amine coupling. This resin has been shown to be useful in the synthesis of thiols, amines, and building blocks.
    Degré de pureté :Min. 95%

    Ref: 3D-RHH-11061-PI

    1g
    220,00€
    5g
    733,00€
  • Ac-LDKNKDPLNETV-NH2


    Peptide Ac-LDKNKDPLNETV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45604

    ne
    À demander
  • Fmoc-Arg(Pbf)-Wang Resin (100-200 mesh) 1% DVB


    Fmoc-Arg(Pbf)-Wang resin is a building block for the synthesis of peptides. It is a resin that is used for the solid phase synthesis of peptides and oligonucleotides with Fmoc chemistry. This resin is provided in powder form, as well as in various particle sizes from 100 to 200 mesh. The resin has been shown to be stable in the presence of DIC/HOBT coupling reactions and can be used with other resins for automated peptide synthesizers.Substitution: 0.3meq/gSwelling: 4.4ml/g (DCM - 30min)
    Degré de pureté :Min. 95%

    Ref: 3D-RFR-1347-PI

    1g
    207,00€
    5g
    588,00€
  • H-LYVTIPLGIK^-OH


    Peptide H-LYVTIPLGIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42633

    ne
    À demander
  • H-K^TTKS-OH


    Peptide H-K^TTKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45560

    ne
    À demander
  • H-Ser(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB


    H-Ser(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin that is designed for the synthesis of peptides. It can be used as a building block and has been shown to react with thiols, alcohols, amines, and other building blocks.
    Degré de pureté :Min. 95%

    Ref: 3D-RHS-11068-PI

    1g
    220,00€
    5g
    733,00€
  • H-LTVEDPVTVEYITR^-OH


    Peptide H-LTVEDPVTVEYITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41489

    ne
    À demander
  • CMVpp65 - 69 (RNGFTVLCPKNMIIK)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Masse moléculaire :1,655.2 g/mol

    Ref: 3D-PP51014

    ne
    À demander
  • H-F^VAPFPE-OH


    Peptide H-F^VAPFPE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42187

    ne
    À demander
  • H-PALEDLR^-OH


    Peptide H-PALEDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40379

    ne
    À demander
  • H-V^V^GGLV^ALR^-OH


    Peptide H-V^V^GGLV^ALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45039

    ne
    À demander
  • Dynorphin B

    CAS :

    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C74H115N21O17
    Masse moléculaire :1,570.8 g/mol

    Ref: 3D-PP50825

    ne
    À demander
  • Apolipoprotein KV domain (67 - 77)


    Vascular lipid deposition and altered lipid profiles are typical when unregulated angiogenesis is occurring, it is often seen in vascular disorders such as cancer and atherosclerosis. Apolipoprotein a (ApoA) functions as part of the lipid transporter complex high-density lipoproteins (HDL) to ensure lipid homeostasis and therefore the balance of angiogenesis. Within ApoA the Kringle5 (KV) domain (67 - 77), also known as KV11, has been identified as the region of ApoA that exerts anti-angiogenic effect. KV11 was shown in tumour cells to inhibit angiogenesis and consequently inhibits tumour progression. KV11 targets the angiogenesis c-Src/ERK pathway by blocking the activation signals received from vascular endothelial growth factor (VEGF). KV11 provides a new research potential for an anti-angiogenesis and anti-tumour therapeutic agent.
    Masse moléculaire :1,447.66 g/mol

    Ref: 3D-CRB1000161

    500µg
    206,00€
    1mg
    282,00€
  • Neuropeptide Y (3-36) Human,Rat


    Neuropeptide Y (NPY) is a peptide involved in the gut-brain axis. Neurons express it in both the brain and the gut. However, expression is significantly increased upon nerve injury. NPY is the most abundant neuropeptide within the brain and is expressed by many neuronal systems, and several important pathways utilising NPY as a neurotransmitter have been identified. Mammalian NPY acts as a vasoconstrictor by affecting blood pressure around peripheral nerves, while it also acts on food intake and emotional regulation.The primary receptor subtypes on which NPY acts in the brain are the Y1 and Y2 receptors but also include Y4, Y5 and y6 (a human pseudogene). Y1 and Y2 increase blood pressure, Y1 and Y5 increase food intake, and Y2 and Y4 decrease food intake.NPY has been linked to psychiatric disorders such as anxiety and depression. Low levels of NPY have been observed in patients with major depressive disorder. Rodent models are used to understand better NPY and its receptors' role in emotional regulation.
    Masse moléculaire :4,271.69 g/mol

    Ref: 3D-CRB1000229

    500µg
    386,00€
    1mg
    470,00€
  • BrAc-TWPKHFDKHTFYSILKLGKH-NH2


    Peptide BrAc-TWPKHFDKHTFYSILKLGKH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Masse moléculaire :2,604.86 g/mol

    Ref: 3D-PP49901

    ne
    À demander
  • CMVpp65 - 8 (RGDTPVLPHETRLLQ)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,732 g/mol

    Ref: 3D-PP50978

    ne
    À demander
  • Kisspeptin 14 human


    The biologically active C-terminal region of Kisspeptin. Kisspeptin, is cleaved from a 145 amino acid precursor to a 54 amino acid peptide in humans and a 52 amino acid peptide in mice. Smaller isoforms of 14, 13 and 10 amino acids have also been isolated in humans, each sharing the common C-terminal sequence. Kisspeptin-14 (KP-14) has equivalent receptor binding efficiency and potency to full length Kisspeptin.Kisspeptin, a product of the KISS1 gene, is a hypothalamic neuropeptide that stimulates gonadotropin-releasing hormone (GNRH) neurons and drives fertility. When energy balance is severely altered (either negatively or positively), Kiss1 expression and fertility are compromised. Kisspeptin neurons are responsible for the transmission of key homeostatic information to GNRH neurons, which is likely to mediate the link between energy balance and fertility. Leptin, ghrelin, pro-opiomelanocortin (POMC), and neuropeptide Y (NPY) have been suggested as modulators of this process.Kisspeptin binds specifically to the G-protein-coupled receptor-54, now known as Kiss1r, which is expressed in almost all GNRH neurons. Kisspeptin plays an essential role in reproduction, and Kiss1r mutations have been isolated in cases of defects in sexual development. Kiss1r is also expressed in other areas of the brain and periphery, highlighting other possible roles for kisspeptin outside of reproduction. Due to kisspeptins importance in reproduction it is synthesized in excess to ensure reproductive success.
    Couleur et forme :Powder
    Masse moléculaire :1,740.8 g/mol

    Ref: 3D-CRB1000930

    500µg
    206,00€
    1mg
    282,00€
  • Hyp3-Bradykinin


    Hyp3-Bradykinin
    Masse moléculaire :1,075.6 g/mol

    Ref: 3D-CRB1001722

    500µg
    206,00€
    1mg
    282,00€
  • H-ESLSSYWESAK^-OH


    Peptide H-ESLSSYWESAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43297

    ne
    À demander
  • β-Amyloid (37-43)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C27H49N7O9
    Masse moléculaire :615.73 g/mol

    Ref: 3D-PP50020

    ne
    À demander
  • LL-37 fragment (30-34)


    LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides.More recently, studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seen with vitamin D treatment for Covid-19.
    Couleur et forme :Powder
    Masse moléculaire :597.4 g/mol

    Ref: 3D-CRB1000674

    500µg
    206,00€
    1mg
    282,00€
  • H-HLDDLK^^-OH


    Peptide H-HLDDLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40095

    ne
    À demander
  • SARS-CoV-2 NSP7 (46-60)


    SARS-CoV-2 NSP7 is part of the RNA-dependent RNA polymerase heterotetramer for mediating coronavirus RNA synthesis. NSP7 and NSP8 form a channel to confer processivity on RNA polymerase. NSP7 aids in stabilising NSP12 regions involved in RNA binding and is essential for a highly active NSP12 polymerase complex. These factors make NSP7 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP7 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP7 (46-60) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.
    Masse moléculaire :1,678.9 g/mol

    Ref: 3D-CRB1001809

    500µg
    206,00€
    1mg
    282,00€
  • H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2


    Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).

    Ref: 3D-PP41946

    ne
    À demander
  • H-LNIPTDVLK^-OH


    Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42147

    ne
    À demander
  • H-ARTKQTARKSTGGKA-NH2


    Peptide H-ARTKQTARKSTGGKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44733

    ne
    À demander
  • TRAP-6

    CAS :
    SFLLRN-amide.
    Couleur et forme :Powder
    Masse moléculaire :747.4 g/mol

    Ref: 3D-CRB1000556

    500µg
    136,00€
    1mg
    206,00€
    5mg
    281,00€
  • Formyl-MLF-[Cys(AF488)]


    Formyl-MLF-[Cys(AF488)] is composed of the chemotactic peptide: N-formyl-methionine-leucine-phenylalanine. N-formyl-methionine is the N-terminal amino acid present on bacteria and allows the bacteria to interact with phagocytic cells such as macrophages and monocyte-derived dendritic cells through surface formyl-MLF receptors. As a result Formyl-MLF labelled with the fluorescent dye, Alexa Fluor 488 can be used as a marker of bacterial infections. It has also been demonstrated that the use of multiple formyl-MLF moieties can target polymeric drug delivery molecules to phagocytic cells. In addition to Alexa Fluor 488's application in marking bacterial infections, its properties of being photo-bleaching resistant and having a high quantum yield allow it to carry out its most common use in the visualisation and location of dendritic structures and synapses.
    Masse moléculaire :1,237.3 g/mol

    Ref: 3D-CRB1110384

    100µg
    386,00€
    500µg
    470,00€
    1mg
    651,00€
  • SARS-CoV-2 NSP13 (231-245)


    The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication.  NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (231-245) is an epitope candidate with various predicted HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.

    Masse moléculaire :1,618.8 g/mol

    Ref: 3D-CRB1001795

    500µg
    206,00€
    1mg
    282,00€
  • [5-FAM]-(KFF)3K


    (KFF)3K is a cationic cell penetrating peptide which can be conjugated to PNA oligomers to aid in their penetration of the bacterial cell wall to function as anti-microbials. It contains 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag.
    Masse moléculaire :1,769.9 g/mol

    Ref: 3D-CRB1101018

    100µg
    206,00€
    500µg
    282,00€
    1mg
    386,00€
  • β-Amyloid (1-40)

    CAS :
    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C194H295N53O58S1
    Masse moléculaire :4,329.86 g/mol

    Ref: 3D-PP50385

    ne
    À demander
  • PLP (178-191)

    CAS :
    PLP(178-191) corresponds to amino acids 178 to 191 of the mouse ProteoLipid Protein (PLP).
    Formule :C70H106N18O22S
    Masse moléculaire :1,583.8 g/mol

    Ref: 3D-PP50831

    ne
    À demander
  • AD01 N-terminal Q


    AD01 is a derivative of the FK506 binding protein-like (FKBPL), and exerts potent anti-angiogenic activity in vitro and in vivo to control tumour growth.Recent studies have shown that AD-01 inhibits Rac-1 activity, and up-regulates RhoA and the actin binding proteins, profilin and vinculin.In this way, the anti-angiogenic proteins, FKBPL, and AD-01, offer a promising and alternative approach for targeting both CD44 positive tumours and vasculature networks. Recent clinical studies have shown that AD01 and other FKBPL-based peptides may offer an alternative for targeting treatment-resistant breast cancer stem cells.
    Masse moléculaire :2,702.4 g/mol

    Ref: 3D-CRB1001065

    500µg
    206,00€
    1mg
    282,00€
  • H-R^FF-OH


    Peptide H-R^FF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45143

    ne
    À demander
  • P2-Hp-1935


    P2-Hp-1935 is an antimicrobial peptide isolated from the skin secretions of the Montevideo tree frog (Hypsiboas pulchellus). P2-Hp-1935 displays activity against Gram positive and negative bacteria.
    Masse moléculaire :1,935.32 g/mol

    Ref: 3D-CRB1000032

    500µg
    206,00€
    1mg
    282,00€
  • H-IWLDNVR^-OH


    Peptide H-IWLDNVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41025

    ne
    À demander
  • HXB2 gag NO-97/aa385 - 399


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Masse moléculaire :1,724.1 g/mol

    Ref: 3D-PP50262

    ne
    À demander
  • H-GIQLVEEELDR^-OH


    Peptide H-GIQLVEEELDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46464

    ne
    À demander
  • Influenza A NP (380-388) (HLA-B8)


    Portion of Influenza NP

    Masse moléculaire :1,192.6 g/mol

    Ref: 3D-CRB1001468

    500µg
    206,00€
    1mg
    282,00€
  • H-ARTKQTARKSTGGKAPRKQLA-NH2


    Peptide H-ARTKQTARKSTGGKAPRKQLA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48598

    ne
    À demander
  • HXB2 gag NO-56/aa221 - 235


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,567.8 g/mol

    Ref: 3D-PP50097

    ne
    À demander
  • Ac-DPKSAAQNSKPRLSFSTKC-NH2


    Peptide Ac-DPKSAAQNSKPRLSFSTKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44437

    ne
    À demander
  • 14-3-3 zeta/delta (28-41)


    14-3-3 proteins are highly conserved from yeast to plants and mammals where they are found in various organs and tissues. 14-3-3 proteins regulate numerous signalling pathways via direct binding to proteins carrying phosphorylated 14-3-3-binding motifs, several hundred binding partners have been identified for 14-3-3 proteins. Their functions include a role in viral infections and innate immunity, protein trafficking, cell-cycle control, apoptosis, autophagy and other cell signal transduction pathways, as well as the associated mechanisms. There are seven 14-3-3 subtypes (alpha/β,γ, ε,η, σ, τ [also called θ] and ζ/δ) in mammals. 14-3-3 ζ has been shown to interact with Hepatitis B virus (HBV) protein X (HBx), E6 oncoprotein, Caspase-2: a protease involved in apoptosis, and to be is involved in the subcellular localisation of the FOXO forkhead transcription factor. 14-3-3 ζ acts as a molecular block that covers the DNA-binding site of FOXO4, thus blocking its interaction with the target DNA. 14-3-3 ζ also participates in the TLR3-TICAM-1 signalling pathway by promoting multimerization of TICAM-1 to form a signalosome. 14-3-3 ζ isoform may also be the target of SARS-CoV-2 in the nervous system.
    Masse moléculaire :1,547.7 g/mol

    Ref: 3D-CRB1001163

    500µg
    206,00€
    1mg
    282,00€
  • H-S^LS^LSPGK^-OH


    Peptide H-S^LS^LSPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47579

    ne
    À demander
  • Angiotensin I (1-9)

    CAS :
    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C56H78N16O13
    Masse moléculaire :1,183.35 g/mol

    Ref: 3D-PP50373

    ne
    À demander
  • Ac-WEDWVGWI-NH2


    Peptide Ac-WEDWVGWI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46400

    ne
    À demander
  • Thyroglobulin (Tg-VIF)


    Thyroglobulin (Tg) is a widely used biomarker of various differentiated thyroid cancer (DTC)- Tg is a substrate for thyroid hormone production. Detection and quantification of serum thyroglobulin levels remain challenging due to Tg's size, heterogeneity, and thyroglobulin autoantibodies (TgAb). Immunoassays offer the opportunity to tailor DTC treatments, but many patients are TgAb positive, excluding them from analysis during regression.Liquid chromatography-tandem mass spectrometry (LC-MS/MS) can overcome immunoassay issues by digestion of Tg to a tryptic peptide removing the interference from TgAbs.
    Masse moléculaire :1,270.7 g/mol

    Ref: 3D-CRB1001706

    500µg
    186,00€
    1mg
    254,00€
  • LCBiot-NLRKSGTLGHPGSL-OH


    Peptide LCBiot-NLRKSGTLGHPGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48877

    ne
    À demander