Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29608 produits trouvés pour "Peptides"
Flu mp 58
CAS :Portion of Influenza MFormule :C49H75N9O11Couleur et forme :PowderMasse moléculaire :966.18 g/molFmoc-Asp(OtBu)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Asp(OtBu)-Wang resin is a 1% DVB resin that can be used as an inhibitor of peptide synthesis. It has been shown to selectively inhibit the binding of the L-type calcium channel, which is a cell membrane protein that affects the transport of calcium ions in and out of cells. Fmoc-Asp(OtBu)-Wang resin binds to the receptor site, preventing the natural ligand from binding. This inhibition prevents the activation of ion channels and reduces calcium ion influx into cells, leading to an anti-inflammatory effect.Degré de pureté :Min. 95%CMVpp65 - 117 (EEDTDEDSDNEIHNP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,758.6 g/molPsalmotoxin 1
CAS :Psalmotoxin 1 is a peptide that is an activator of ion channels. It has been shown to bind to the acetylcholine receptor, nicotinic acetylcholine receptor, and the glycine receptor. It also inhibits protein interactions with its high-affinity binding affinity for the alpha-subunit of phospholipase A2.Formule :C200H318N62O57S6Degré de pureté :Min. 95%Masse moléculaire :4,695.42 g/molH-TFPGFFSPMLGEFVSETVSR^-OH
Peptide H-TFPGFFSPMLGEFVSETVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Decanoyl-RWKFGGFKWR-OH
Peptide Decanoyl-RWKFGGFKWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGEGTYGVVYK^-OH
Peptide H-IGEGTYGVVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Myr-KRMKVAKNAQ-OH
Peptide Myr-KRMKVAKNAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ala-2-ClTrt-Resin (200-400 mesh) 1% DVB
For preparation of acids, alcohols, thiols, or aminesDegré de pureté :Min. 95%Cyclo[CO-(CH2)2-CO-D-Nal(2')-Arg-Trp-Lys]-NH2
Cyclo[CO-(CH2)2-CO-D-Nal(2')-Arg-Trp-Lys]-NH2 is a peptide that blocks the melanocortin receptor and inhibits the synthesis of MSH. Cyclo[CO-(CH2)2-CO-D-Nal(2')-Arg-Trp-Lys]-NH2 has been shown to inhibit the growth of cancer cells in culture. It also has antiinflammatory properties and is used for the treatment of skin conditions such as psoriasis and vitiligo.Formule :C40H48N9O7Degré de pureté :Min. 95%Masse moléculaire :766.88 g/molalpha-Mating Factor acetate salt
CAS :Alpha-Mating Factor acetate salt is a complex compound that is a useful intermediate, building block, and reaction component. Alpha-Mating Factor acetate salt has been shown to be a useful scaffold for the synthesis of other compounds. It can also be used as a reagent in research or as a speciality chemical. Alpha-Mating Factor acetate salt is soluble in water and most organic solvents, making it versatile in its applications.Formule :C82H114N20O17S·xC2H4O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,683.97 g/molH-SWFEPLVEDMQR^-OH
Peptide H-SWFEPLVEDMQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVYFYAPQIPLYANK^-OH
Peptide H-AVYFYAPQIPLYANK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Phe-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Phe-2-ClTrt-Resin (200-400 mesh) 1% DVB is a resin for peptide synthesis. It can be used in the synthesis of thiols, building blocks, alcohols and amines with 1% DVB.Degré de pureté :Min. 95%Orexin A (human) TFA
CAS :Orexin A (human) TFA is a high quality reagent that can be used as an intermediate in the synthesis of complex compounds, useful for research and development. It has many potential uses, including as a fine chemical, speciality chemical and reaction component. Orexin A (human) TFA is a versatile building block with many applications, such as being a useful scaffold or building block in reactions where it can be used in the synthesis of other compounds. It is also a valuable research chemical that can be used to study orexin receptors and their ligands.
Formule :C152H243N47O44S4•C2HF3O2Degré de pureté :Min. 95 Area-%Couleur et forme :White Off-White PowderMasse moléculaire :3,675.13 g/molH-FLEQELETITIPDVYGAK^-OH
Peptide H-FLEQELETITIPDVYGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biotinylated TAT (47-57)
Biotinylated Tat Peptide available in the trifluroacetate salt form. TAT(Transactivated-transcripiton) Peptide Derived from the HIV TAT Protein, is a Cell-Penetrating Peptide which has the ability to transport itself across cell membranes independently. Cell penetrating peptides (CPPs) can be used to carry other molecules into the cell and therefore can be used in many applications. Such applications may include: drug delivery, where small drug peptides or nucleic acids can be delivered into target cells or where CPPs are conjugated to imaging agents such as fluorescent dyes or radiolabeled molecules they can be used for in vivo or in vitro imaging in diagnostics.Formule :C74H132N34O16SDegré de pureté :Min. 95%Masse moléculaire :1,786.16 g/molRACGAP1
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolSuc-Ala-Val-Pro-Phe-pNA
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C32H40N6O9Masse moléculaire :652.7 g/molHepcidin-24 (Human)
Consisting of the disulfide Bonds: Cys6- Cys22, Cys9-Cys12, Cys10- Cys18, and Cys13-Cys21 and of the trifluoroacetate salt form, this product can be used as an internal standard for Hepcidin assays.Hepcidin-24 is a peptide hormone that plays a key role in the regulation of iron metabolism in the body. It is produced by the liver and is secreted into the bloodstream, where it interacts with cells in the intestine and other tissues to control the absorption and distribution of iron. Hepcidin acts as a negative regulator of iron uptake and release by binding to and inhibiting the activity of ferroportin, a protein that facilitates the export of iron from cells into the bloodstream. When hepcidin levels are high, ferroportin activity is reduced, leading to decreased iron absorption from the diet and reduced iron release from cells. When hepcidin-24 levels are low, ferroportin activity is increased, leading to increased iron absorption and release. Imbalances in hepcidin levels can lead to a variety of disorders, including iron-deficiency anemia, hemochromatosis (an iron overload disorder), and anemia of chronic disease. Therefore, hepcidin-24 is a key target for the development of treatments for these and other iron-related disorders. In addition to its role in iron metabolism, hepcidin has been shown to have antimicrobial properties, as it can inhibit the growth of certain bacteria and fungi. It may also be involved in the regulation of immune function and inflammation.Formule :C109H165N33O28S9Degré de pureté :Min. 95%Masse moléculaire :2,674.31 g/molH-YFIDFVAR^-OH
Peptide H-YFIDFVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAAQK^TDTSHHDQDHPTF-OH
Peptide H-DAAQK^TDTSHHDQDHPTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLMEQIPHL^-OH
Peptide H-SLMEQIPHL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AEIEYLEK^-OH
Peptide H-AEIEYLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Hepcidin (canine)
This product is a Liver-Expressed Antimicrobial Peptide of Canine source containing the disulfide Bonds: Cys7-Cys23, Cys10-Cys13, Cys11-Cys19, and Cys14-Cys22. Hepcidin is a peptide hormone that controls the release of iron from storage cells in the liver. It inhibits erythropoiesis by limiting the availability of iron for red blood cell production. This peptide also exhibits anti-microbial properties in that in response to inflammatory cytokines hepcidin leads to a decreased release of iron from enterocytes, hepatocytes and macrophages and further leads to ferroportin degradation and internalization. This product may be useful for use in research into disorders where iron dysregulation is paramount for pathogenesis and also in inflammatory diseases.Degré de pureté :Min. 95%H-TFRRRL-NH2
Peptide H-TFRRRL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CKLQHVYKRLAMGDNVL-OH
Peptide Ac-CKLQHVYKRLAMGDNVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyclo[Arg-Gly-Asp-D-Phe-Lys(Biotin)]
Cyclo[Arg-Gly-Asp-D-Phe-Lys(Biotin)] is a peptide macrocycle that is known to bind to integrin and be active against cancer cells. It has been shown to inhibit the growth of cancer cells by inhibiting cell adhesion, which leads to a reduction in the production of biochemicals such as fibronectin. Cyclo[Arg-Gly-Asp-D-Phe-Lys(Biotin)] binds strongly to the integrin receptor on the surface of many types of cancer cells, including those that are resistant to conventional chemotherapy drugs. This peptide macrocycle also inhibits proteolytic cleavage by metalloproteinases and enhances tumor vascularization, making it an attractive candidate for use in cancer treatment.Formule :C37H55N11O9SDegré de pureté :Min. 95%Masse moléculaire :829.98 g/mol5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 envelope - 86
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :2,478 g/molH-VAIDVGYR^-OH
Peptide H-VAIDVGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.α-Neo-Endorphin, porcine
CAS :Custom research peptide; min purity 95%.Formule :C60H89N15O13Degré de pureté :Min. 95%Masse moléculaire :1,228.47 g/molSendai Virus Nucleoprotein (SV9), 324-332
Custom research peptide; min purity 95%.
Formule :C46H64N10O12Degré de pureté :Min. 95%Masse moléculaire :949.08 g/molFluor-GSRAHSSHLKSKKGQSTSRHKK-OH
Peptide Fluor-GSRAHSSHLKSKKGQSTSRHKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Suc-Glu-Ala-Leu-Phe-Gln-pNA
Suc-Glu-Ala-Leu-Phe-Gln-pNA is a substrate for human rhinovirus 3C protease. The peptide is a mixture of four amino acids and has been synthesized to serve as an inhibitor of the HRV3C protease enzyme. Suc-Glu-Ala-Leu-Phe-Gln-pNA is expected to inhibit the HRV3C protease by binding to the active site, thereby preventing cleavage of viral proteins that are needed for replication.Formule :C38H50N8O13Degré de pureté :Min. 95%Masse moléculaire :826.87 g/molLCBiot-QYTSIHHGVVEVD-OH
Peptide LCBiot-QYTSIHHGVVEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FIIPQIVK^-OH
Peptide H-FIIPQIVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.TNF α Canine
TNF-α is a cytokine that regulates the immune system by stimulating the production of other proteins called cytokines. It also inhibits the growth of bacteria such as Escherichia coli and some viruses. TNF-α has been shown to have a wide range of effects on cells, including inducing cell death (apoptosis) and inhibiting protein synthesis. It is a non-glycosylated polypeptide with molecular mass of 17.3kDa.Degré de pureté :Min. 95%LCBiot-KKWKMRRNQFWVKVQRG-OH
Peptide LCBiot-KKWKMRRNQFWVKVQRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Wang Resin (100-200 mesh) 1% DVB
Unsubstituted Resins for Solid Phase SynthesisDegré de pureté :Min. 95%VP2 (70-86)
VP2 (70-86) is a peptide that is associated with the viral protein VP2. It has been shown to be immunogenic and may be used in the treatment of experimental autoimmune encephalomyelitis (EAE). VP2 (70-86) is a Biologically Active Peptide and can be used for research purposes.
Formule :C93H138N26O25Degré de pureté :Min. 95%Masse moléculaire :2,020.3 g/mol(Des-Glu²²)-Amyloid β-Protein (1-40)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C189H288N52O55SMasse moléculaire :4,200.75 g/molMBP (69-88)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :2,316.5 g/molBiot-GRGRGRGRGRGRG-NH2
Peptide Biot-GRGRGRGRGRGRG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
GAD65 (206-220)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C86H129N15O24Masse moléculaire :1,757.07 g/molBeta-2 Microglobulin Human
Beta-2 Microglobulin Human is a research tool that can be used to study the activation of receptors, ion channels, and protein interactions. It is a ligand that binds to cell surface receptors. It is also an inhibitor that blocks the formation of antibodies by binding to human immunoglobulin G (IgG) and prevents it from binding to antigens. Beta-2 Microglobulin Human is a high purity protein with a CAS number of 1768-01-7.Degré de pureté :Min. 95%SIVmac239 - 111
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,695 g/mol5-Fam-ShK
A labeled synthetic Sea Anemone toxin; a useful tool for detection of the presence of T-Lymphocytes with high expression of Kv13 channels in normal and diseased tissue. This product is available in the salt form: trifluoroacetate and has the following disulfide bonds: Cys3 and Cys35; Cys12 and Cys28; Cys17 and Cys32.Formule :C196H296N56O56S7Degré de pureté :Min. 95%Masse moléculaire :4,557.33 g/molFluor-YGGFM-OH
Peptide Fluor-YGGFM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AILNYIASK^-OH
Peptide H-AILNYIASK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![Cyclo[CO-(CH2)2-CO-D-Nal(2')-Arg-Trp-Lys]-NH2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPMC-3887-PI.webp&w=3840&q=75)
![Cyclo[Arg-Gly-Asp-D-Phe-Lys(Biotin)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPCI-3895-PI.webp&w=3840&q=75)
