CymitQuimica logo
Peptides

Peptides

Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.

Sous-catégories appartenant à la catégorie "Peptides"

30318 produits trouvés pour "Peptides"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • CMVpp65 - 76 (HFGLLCPKSIPGLSI)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,582 g/mol

    Ref: 3D-PP50909

    ne
    À demander
  • Nangibotide

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C54H82N14O22S2
    Masse moléculaire :1,343.44 g/mol

    Ref: 3D-PP50933

    ne
    À demander
  • Fmoc-GRGDSPK-OH


    <p>Peptide Fmoc-GRGDSPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49590

    ne
    À demander
  • Biot-ERGVT-OH


    Peptide Biot-ERGVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46554

    ne
    À demander
  • H-IIPGGIYDADLNDEWVQR^-OH


    Peptide H-IIPGGIYDADLNDEWVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41205

    ne
    À demander
  • H-GSSDVDQLGK^-OH


    <p>Peptide H-GSSDVDQLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49696

    ne
    À demander
  • HXB2 gag NO-67


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,803.2 g/mol

    Ref: 3D-PP51027

    ne
    À demander
  • H-IQPTTPSEPTAIK^-OH


    <p>Peptide H-IQPTTPSEPTAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47451

    ne
    À demander
  • Ac-PEK-NH2


    Peptide Ac-PEK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43870

    ne
    À demander
  • HCMV IE1 81-89 (HLA-A*02:01)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50761

    ne
    À demander
  • Ac-PGP-OH


    <p>Peptide Ac-PGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43361

    ne
    À demander
  • H-ILDFGLAR^-OH


    <p>Peptide H-ILDFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45183

    ne
    À demander
  • Ac-HHHHHHC-OH


    <p>Peptide Ac-HHHHHHC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45236

    ne
    À demander
  • Ac-RGDY-NH2


    Peptide Ac-RGDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46237

    ne
    À demander
  • H-VAPEEHPVLLTEAPLNPK^-OH


    Peptide H-VAPEEHPVLLTEAPLNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00524

    ne
    À demander
  • Aoa-KSKTKC-OH


    Peptide Aoa-KSKTKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PA00021

    ne
    À demander
  • Ac-VGVAPG-NH2


    Ac-VGVAPG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

    Ref: 3D-PA00018

    ne
    À demander
  • H-ISIDVNNNDIK^-OH


    Peptide H-ISIDVNNNDIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00267

    ne
    À demander
  • H2NCO-HAEGTFTSDVSSYLEGQ-NH2


    <p>Peptide H2NCO-HAEGTFTSDVSSYLEGQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00222

    ne
    À demander
  • H-IGSEAYNQQLSEK^-OH


    <p>Peptide H-IGSEAYNQQLSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00254

    ne
    À demander
  • Ac-QQRFEWEFEQQ-NH2


    Peptide Ac-QQRFEWEFEQQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
    Formule :C72H98O22N20
    Masse moléculaire :1,595.7 g/mol

    Ref: 3D-PA00009

    ne
    À demander
  • Ac-NIQLINTNGSWHINST-NH2


    Peptide Ac-NIQLINTNGSWHINST-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PA00008

    ne
    À demander
  • H-YGNGVWIGR^-OH


    Peptide H-YGNGVWIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00586

    ne
    À demander
  • pE-LYENKPRRP^YIL^


    pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
    Formule :C73H116N20O18
    Masse moléculaire :1,561.84 g/mol

    Ref: 3D-PP00002

    ne
    À demander
  • H-LNNISIIGPLDMK^-OH


    Peptide H-LNNISIIGPLDMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00329

    ne
    À demander
  • H-GQSIQPFISR^-OH


    <p>Peptide H-GQSIQPFISR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00204

    ne
    À demander
  • H-QLSESQVK^-OH


    Peptide H-QLSESQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00402

    ne
    À demander
  • H-CSCSSLMDKECVY^FCHLDIIW^VNTPEHVVPYGL^GSPRS-OH


    <p>H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PH00064

    ne
    À demander
  • H-TYLPAVDEK^-OH


    <p>Peptide H-TYLPAVDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43192

    ne
    À demander
  • H-LGYPITDDLDIYTR^-OH


    Peptide H-LGYPITDDLDIYTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00315

    ne
    À demander
  • H-LEETVQAK^-OH


    Peptide H-LEETVQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00308

    ne
    À demander
  • SIVmac239 - 124


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,714.9 g/mol

    Ref: 3D-PP50026

    ne
    À demander
  • H-QIVQNLR^-OH


    Peptide H-QIVQNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00397

    ne
    À demander
  • H-AVEIGSFLLGR^-OH


    Peptide H-AVEIGSFLLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00050

    ne
    À demander
  • H-EEQYNSTYR^-OH


    <p>Peptide H-EEQYNSTYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49475

    ne
    À demander
  • H-YFDSFGDLSSASAIMGNAK^-OH


    <p>Peptide H-YFDSFGDLSSASAIMGNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00582

    ne
    À demander
  • 5TAMRA-LKRYKRRL-OH


    Peptide 5TAMRA-LKRYKRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PT00001

    ne
    À demander
  • H-SEVAHR^-OH


    Peptide H-SEVAHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00458

    ne
    À demander
  • H-NVDLSTFYQNR^-OH


    Peptide H-NVDLSTFYQNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00379

    ne
    À demander
  • MBP (63-81)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,645.1 g/mol

    Ref: 3D-PP51040

    ne
    À demander
  • H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQRY-NH2


    H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
    Formule :C194H295N55O57
    Masse moléculaire :4,309.81 g/mol

    Ref: 3D-PH00600

    ne
    À demander
  • Trp-Asn-Phe-Ala-Gly-Ile-Glu-Ala-Ala-Ala-Ser-Ala-Il


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C68H100N18O21
    Masse moléculaire :1,505.63 g/mol

    Ref: 3D-PP50091

    ne
    À demander
  • H-LANDAAQVK^-OH


    <p>Peptide H-LANDAAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47408

    ne
    À demander
  • H-NGFFF-NH2


    Peptide H-NGFFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43144

    ne
    À demander
  • H-LPDATPK^-OH


    <p>Peptide H-LPDATPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46766

    ne
    À demander
  • H-R^PHFPQFSYSASGTA-OH


    <p>Peptide H-R^PHFPQFSYSASGTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48117

    ne
    À demander
  • 5Azido-AAAYSSGAPPMPPF-OH


    <p>Peptide 5Azido-AAAYSSGAPPMPPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43632

    ne
    À demander
  • H-A^^P^^G^^-OH


    <p>Peptide H-A^^P^^G^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49290

    ne
    À demander
  • Ac-PAVLQSSGLYSLSSVVTVPSSSLGTQ-NH2


    <p>Peptide Ac-PAVLQSSGLYSLSSVVTVPSSSLGTQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43860

    ne
    À demander
  • Val-Ile-Ile


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C17H33N3O4
    Masse moléculaire :343.46 g/mol

    Ref: 3D-PP50668

    ne
    À demander