CymitQuimica logo
Peptides

Peptides

Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.

Sous-catégories appartenant à la catégorie "Peptides"

30315 produits trouvés pour "Peptides"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • H-YGGFLRRIRPKLK^WDNQ-OH


    <p>Peptide H-YGGFLRRIRPKLK^WDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49520

    ne
    À demander
  • Octreotide


    <p>Peptide Octreotide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49921

    ne
    À demander
  • H-ILDFGLAR^-OH


    <p>Peptide H-ILDFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45183

    ne
    À demander
  • Ac-HHHHHHC-OH


    <p>Peptide Ac-HHHHHHC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45236

    ne
    À demander
  • Ac-RGDY-NH2


    Peptide Ac-RGDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46237

    ne
    À demander
  • H-RR^-OH


    Peptide H-RR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46190

    ne
    À demander
  • H-FPLTNAIK^-OH


    <p>Peptide H-FPLTNAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00163

    ne
    À demander
  • H-STDTAYMELSSLR^-OH


    Peptide H-STDTAYMELSSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00473

    ne
    À demander
  • H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVL^VQREKDL^PNYNWNSFGL^RF-NH2


    <p>H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>
    Formule :C258H401N79O78
    Masse moléculaire :5,857.5 g/mol

    Ref: 3D-PH00214

    ne
    À demander
  • H-TANDLNLLILR^-OH


    <p>Peptide H-TANDLNLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00486

    ne
    À demander
  • H-HEAWITLEK^-OH


    Peptide H-HEAWITLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00226

    ne
    À demander
  • H-FLPLIGRVLSGIL-NH2


    <p>Peptide H-FLPLIGRVLSGIL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43511

    ne
    À demander
  • Cy5-TFSDLWKLL-OH


    <p>Peptide Cy5-TFSDLWKLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PC00002

    ne
    À demander
  • H2N-GIGTIISSPYR-OH


    Peptide H2N-GIGTIISSPYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00223

    ne
    À demander
  • H-IPNAGQMQPVK^-OH


    Peptide H-IPNAGQMQPVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00264

    ne
    À demander
  • LCBiot-YAPP-OH


    Peptide LCBiot-YAPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46912

    ne
    À demander
  • H-GAGTDDHTLIR^-OH


    <p>Peptide H-GAGTDDHTLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49007

    ne
    À demander
  • H-SVSEIQLMHNLGK^HLNSMERVEWLRKKLQDVHN-OH


    H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

    Ref: 3D-PH00480

    ne
    À demander
  • H-LFDNAMLR^-OH


    Peptide H-LFDNAMLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00311

    ne
    À demander
  • H-LVMEYLPSGCLR^-OH


    <p>Peptide H-LVMEYLPSGCLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44302

    ne
    À demander
  • H-AFDQIDNAPEEK^-OH


    Peptide H-AFDQIDNAPEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00021

    ne
    À demander
  • H-CSCSSLMDKECVY^FCHLDIIW^-OH


    H-CSCSSLMDKECVYFCHLDIIW-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
    Formule :C109H163N25O32S5
    Masse moléculaire :2,495.97 g/mol

    Ref: 3D-PH00063

    ne
    À demander
  • H-AASLDGFYNGR^-OH


    <p>Peptide H-AASLDGFYNGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00014

    ne
    À demander
  • Ac-RFGRFLRKILRFLKK-NH2


    <p>Peptide Ac-RFGRFLRKILRFLKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PA00012

    ne
    À demander
  • Defensin-1 (human) HNP-1

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C150H222N44O38S6
    Masse moléculaire :3,442.1 g/mol

    Ref: 3D-PP50184

    ne
    À demander
  • H-VAPEEHPVLLTEAPLNPK^-OH


    Peptide H-VAPEEHPVLLTEAPLNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00524

    ne
    À demander
  • Aoa-KSKTKC-OH


    Peptide Aoa-KSKTKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PA00021

    ne
    À demander
  • Ac-VGVAPG-NH2


    Ac-VGVAPG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

    Ref: 3D-PA00018

    ne
    À demander
  • H-GTVGGYFL^AGR^-OH


    Peptide H-GTVGGYFL^AGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00216

    ne
    À demander
  • H-QTALVELVK^-OH


    <p>Peptide H-QTALVELVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00412

    ne
    À demander
  • H-FALPQYLK^-OH


    <p>Peptide H-FALPQYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
    Formule :C49H74N10O11
    Masse moléculaire :979.18 g/mol

    Ref: 3D-PH00140

    ne
    À demander
  • H-PQNLLLDPDTAVLK^-OH


    <p>Peptide H-PQNLLLDPDTAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41089

    ne
    À demander
  • H-LDELLQSQIEK^-OH


    <p>Peptide H-LDELLQSQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00301

    ne
    À demander
  • H-Myr-GSNK^SK^PK-NH2


    <p>Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00359

    ne
    À demander
  • H-K^CNTA^TCATQRLANFLVHSSNNFGAILSSTNVG^SNTY-NH2


    <p>H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PH00273

    ne
    À demander
  • H-LDLER^-OH


    Peptide H-LDLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00304

    ne
    À demander
  • δ-MSH


    <p>Peptide ÎŽ-MSH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
    Formule :C74H99N21O16S
    Masse moléculaire :1,570.81 g/mol

    Ref: 3D-PP47636

    ne
    À demander
  • H-FFVPPFQQSPR^-OH


    Peptide H-FFVPPFQQSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00143

    ne
    À demander
  • H-QFYDQALQQAVVDDDANNAK^-OH


    Peptide H-QFYDQALQQAVVDDDANNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00392

    ne
    À demander
  • H-DLPAPITR^-OH


    Peptide H-DLPAPITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00089

    ne
    À demander
  • H-NFLINETAR^-OH


    Peptide H-NFLINETAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00366

    ne
    À demander
  • H-YLWEWASVR^-OH


    <p>Peptide H-YLWEWASVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00595

    ne
    À demander
  • H-G^PSLFPLAPSSK^-OH


    <p>Peptide H-G^PSLFPLAPSSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42563

    ne
    À demander
  • Fmoc-PFAV


    Peptide Fmoc-PFAV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PF00002

    ne
    À demander
  • HXB2 gag NO-95/aa377 - 391


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,906.3 g/mol

    Ref: 3D-PP50436

    ne
    À demander
  • H-IVGGWECEK^-OH


    Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00270

    ne
    À demander
  • H-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-NH2


    H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
    Formule :C190H288N54O57
    Masse moléculaire :4,240.7 g/mol

    Ref: 3D-PH00028

    ne
    À demander
  • H-HSQGTFTSDYSK^YLDSRRAQDFVQWLMNTKR^NRNNIA-OH


    H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
    Formule :C192H295N61O60S
    Masse moléculaire :4,449.9 g/mol

    Ref: 3D-PH00240

    ne
    À demander
  • H-NAVEVLKR^-OH


    Peptide H-NAVEVLKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00364

    ne
    À demander
  • gp100 (86-95)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50508

    ne
    À demander