Peptides

<p>Peptide H-NQLTSNPENTVFDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-LVDQNIFSFYLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Human Hepcidin peptide hormone product also know as LEAP-1 (liver-expressed antimicrobial peptide), where the disulfides are formed by random oxidation. Hepcidin is a peptide hormone that is synthesized in the liver and is an important regulator of iron homeostasis. Through binding to ferroportin Hepcidin prevents the exportation of iron thus reducing the amount of circulating iron. Furthermore through inflammatory cytokine induction Hepcidin leads to the internalization and degradation of ferroportin thus further reducing the amount of iron in circulation. This in turn make conditions unfavourable to invading pathogens. This demonstrates Hepcidin's ability as an anti-microbial peptide. This antimicrobial behaviour can be used in research into the elimination of pathogens but also in combatting diseases where iron dysregulation is prevalant.Disulfide bonds between C7-C23; C10-C13; C11-C19; C14-C22

<p>Biotinoylsarcosine is a synthetic compound that is used in biotechnology as a building block for the production of biotin-conjugated proteins and peptides. Biotinoylsarcosine has been shown to bind to human serum albumin with high affinity, which may be due to its carboxylate functionalities. This chemical can also be conjugated with other molecules through multistep reactions, simplifying the process of creating biotin-conjugated compounds. Biotinoylsarcosine is deactivated by biotinidase enzymes and used as a pretargeting agent in positron emission tomography imaging studies. Streptavidin, an avidin protein, can bind this compound with high affinity and has been used in biochemical studies as a tool for peptide synthesis.</p>

Peptide H-NPIYSNNFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-GYAGTLQSL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-TARKSTGGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-DRV^^YIHPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Rhod-VPMLKE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-MEVGWYRSPFSRVVHLYRNGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

RS09/Toll Like Receptor (TLR) 4 agonist – APPHALS

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VNSQSLSPYLFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Acetyl Hexapeptide-3 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Leupeptin is an ion channel blocker that belongs to the group of protease inhibitors. It blocks the passage of ions across cell membranes by binding to the active site of a variety of enzymes in the membrane. Leupeptin is used as a research tool for studying protein interactions, and can be used for antibody production. Leupeptin is also useful in cell biology studies, because it inhibits the activation of many proteins involved in signal transduction and cell division.

Peptide H-VL^IGLDLLYGELQDSDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Chloromethylated Polystyrene Resin (200-400 mesh) 1% DVB is a reaction solution that is used in biological studies. It reacts with human serum to form a bicyclic heterocycle. The hydrogen fluoride in the reaction solution reacts with the trifluoroacetic acid to form an intermediate, which then reacts with the chloromethylated polystyrene resin to form the bicyclic heterocycle. The redox potentials of this reaction are measured and can be used as a probe for determining the chemical stability of this product. This product has been shown to have fluorescence properties and can be used as a probe for detecting DNA and RNA samples in vitro.

Peptide H-MLEVPYVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ASSIIDELFQDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-MGK^LSKIWDLPLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide LCBiot-DIPIGAGICASYHTVSLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Boc-D-Ala-OH is a chiral amino acid that can be used in the synthesis of peptides. Boc-D-Ala-OH is a building block for the synthesis of amino acids, and it can also be used as a ligand to form metal complexes. This product has been shown to be effective in reducing optical activity through chemoenzymatic reduction processes. Boc-D-Ala-OH has also been shown to be hydrolyzed by various enzymes, including alcohols and acrylates.</p>

<p>Peptide H-GLDKDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-SLKLMATLFSTYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Biot-KRRRALSVASLPGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VVVGAGDVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-DRV^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>FS1, a synthetic BH3 peptide used in BH3 profiling, shows promise in enhancing Natural Killer (NK) cell-mediated cancer therapy. By selectively targeting anti-apoptotic BCL-2 family proteins, FS1 can trigger cytochrome c release in sensitive cancer cell lines, promoting apoptosis. This mechanism synergizes with NK cell activity, leading to increased cancer cell death both in vitro and in vivo. Therefore, FS1 represents a potential therapeutic agent for enhancing NK cell-based immunotherapy approaches.</p>

Peptide H-NLHQPPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-CNTATCATQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LIYDSSLCDL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-TFRRRLSRATR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-ALDAAYCFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-HVPGGGSVQIVYKPVDLSKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-S^LSLSPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RSGPPGLQGRLQRLLQASGNHAAGILTM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Mca-Pro-Leu-OH is a monoclonal antibody that recognizes the antigen staphylococcus. It is useful for the diagnosis of postoperative infections, nephrology dialysis, and in renal transplantation to prevent graft rejection. It has been used as an immunofluorescent stain in human chorionic gonadotropin (hCG) and follicle stimulating hormone (FSH) studies. Mca-Pro-Leu-OH is a mouse monoclonal antibody that reacts with human chorionic gonadotropin (hCG). The specificity of this antibody has been shown to be very high since it does not react with other proteins found in nature such as follicle stimulating hormone (FSH).

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide Ac-CEKEEDERVQGGDREPLLQEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>