
Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30306 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-Ser-Phe-Asn-Gly-Gly-Pro-NH2
CAS :<p>H-Ser-Phe-Asn-Gly-Gly-Pro-NH2 is a peptide that activates Protease Activated Receptor 1 (PAR1) and Protease Activated Receptor 3 (PAR3). It also has been shown to decrease blood pressure in mice, inhibit coagulation, and increase the breakdown of fibrin clots. This product is a ligand for PAR1 and PAR3. It has been shown to activate these receptors by binding to them through its amino acid sequence. HSPNP binds to proteases that cleave the peptide from the receptor, which leads to activation of the receptor. HSPNP can also bind to PAR3 and PAR4.</p>Formule :C25H36N8O8Degré de pureté :Min. 95%Masse moléculaire :576.61 g/molH-RR^-OH
Peptide H-RR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LHVDPENFR^^-OH
Peptide H-LHVDPENFR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-ß-Ala-OH
CAS :<p>Fmoc-ß-Ala-OH is a synthetic amino acid that is used in the synthesis of cyclic peptides. It has been shown to have receptor activity, such as the ability to bind to an erythrocyte membrane protein. Fmoc-ß-Ala-OH is also able to stimulate macrophage-like cells and polypeptide synthesis. Fmoc-ß-Ala-OH has been synthesized by chemical ligation, followed by purification on an agarose gel. This synthetic amino acid is used as a building block for affinity ligands, which are compounds that bind to specific receptors or other molecules with high specificity and affinity.</p>Formule :C18H17NO4Degré de pureté :Min. 98.0 Area-%Masse moléculaire :311.34 g/molK-252A
CAS :<p>K-252A is an antimicrobial agent that inhibits the growth of bacteria. It binds to the response element in the promoter region of genes and blocks gene transcription, thereby preventing protein synthesis. K-252A has been shown to inhibit the growth of bacteria that are resistant to many other antibiotics, including ampicillin, chloramphenicol, clindamycin, erythromycin, gentamicin and kanamycin. This drug also induces significant up-regulation of cyclic nucleotide phosphodiesterases (PDE) and cytosolic Ca2+ in vitro. K-252A has been shown to cause neuronal death in vitro by inhibiting axonal growth. K-252A also inhibits leukemia inhibitory factor (LIF) from binding to its receptor on mouse lymphocytes.</p>Formule :C27H21N3O5Degré de pureté :Min. 95%Masse moléculaire :467.49 g/molH-FPLTNAIK^-OH
Peptide H-FPLTNAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Hepcidin-25 (human) trifluoroacetate salt
CAS :Please enquire for more information about Hepcidin-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C113H170N34O31S9·C2HF3O2Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :2,903.38 g/molH-STDTAYMELSSLR^-OH
Peptide H-STDTAYMELSSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PEPTIDE 1
Peptide PEPTIDE 1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peptide YY (Dog, Mouse, Porcine, Rat, 3-36)
CAS :PYY (3-36), a Y2 receptor agonist, is released from the body's gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which suggests that PYY (3-36) has a role in 'longer term' regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drugs for the treatment of obesity. This product is available as an Acetate salt.Formule :C176H272N52O54Degré de pureté :Min. 95%Masse moléculaire :3,980.45 g/molLCBiot-RLDGNEIKR-NH2
Peptide LCBiot-RLDGNEIKR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VISPSEDR^-OH
Peptide H-VISPSEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVL^VQREKDL^PNYNWNSFGL^RF-NH2
<p>H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formule :C258H401N79O78Masse moléculaire :5,857.5 g/molH-TANDLNLLILR^-OH
<p>Peptide H-TANDLNLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFPGFFSPMLGEFVSETVSR^-OH
<p>Peptide H-TFPGFFSPMLGEFVSETVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>OVA Peptide (257-264)
CAS :<p>SIINFEKL sequence.OVA Peptide (257-264) is a fragment of the OVA protein that stimulates an antibody response. It has been shown to activate various types of immune cells, such as T-cells, B-cells and macrophages.</p>Formule :C45H74N10O13Degré de pureté :Min. 95%Masse moléculaire :963.15 g/molMyelin PLP (139-151) acetate
CAS :<p>Myelin PLP (139-151) acetate salt is a cyclic peptide that is derived from the sequence of human myelin basic protein and contains the sequence PLP (139-151). This peptide has shown to have antioxidative properties. It has been shown to have an inhibitory effect on the production of proinflammatory cytokines in experimental autoimmune encephalomyelitis (EAE), which is a model for multiple sclerosis. The peptide has also been shown to block signal pathways, such as toll-like receptor 4, and decrease Ca2+ overload. Clinical relevance remains unclear.</p>Formule :C72H104N20O17•(C2H4O2)xDegré de pureté :Min. 95%Masse moléculaire :1,521.76 g/molAlpha-Mating Factor
CAS :<p>Alpha-Mating Factor is a peptide that belongs to the group of ligands. It has been shown to bind to the androgen receptor with high affinity and act as an activator for this receptor. Alpha-Mating Factor is also able to bind to the beta-adrenergic receptor. This protein has been shown to have ion channel activity, which may be due to its inhibition of potassium channels. Alpha-Mating Factor is used in research as a tool for studying cell biology and cell signalling pathways.</p>Formule :C82H114N20O17SDegré de pureté :Min. 95%Masse moléculaire :1,684 g/molPTH-rP (Human, 7-34 Amide)
CAS :PTH-rP (Human, 7-34 Amide), sourced from rat, and mouse and available as a 0.5mg vial, is an antagnoist of the A Parathyroid Hormone related Peptide (PTH-rP). PTH-rP is a peptide that belongs to the group of activators. PTH-rP has been shown to activate phospholipase C, which leads to increased intracellular calcium levels and activation of protein kinase C. PTH-rP also binds to the receptor for parathyroid hormone (PTH), and activates it by binding to its extracellular domain. This receptor is found in most cells in the body, including those in bone, kidney, gut and brain. The ligand-receptor interaction causes an increase in intracellular calcium levels that triggers a cascade of downstream effects on cell metabolism and gene expression.Formule :C153H247N49O37Degré de pureté :Min. 95%Masse moléculaire :3,364.9 g/molH-HEAWITLEK^-OH
Peptide H-HEAWITLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2
CAS :<p>Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2 is an enzyme substrate that acts as a competitive inhibitor of the hepatitis C protease. It has been shown to inhibit the activity of the hepatitis C protease in cell culture, and can be used to identify other inhibitors of this protease. Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2 is a peptide with an amino acid sequence that is not found in any known proteins.</p>Formule :C68H89N15O25SDegré de pureté :Min. 95%Masse moléculaire :1,548.62 g/molH-FAGVFHVEK^-OH
<p>Peptide H-FAGVFHVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Diprotin A
CAS :<p>Diprotin A is a peptide that is involved in cell signaling and has been shown to interact with ion channels and receptors. It is an activator of the Fc receptor, which is responsible for the activation of immune cells. This peptide can also be used as a research tool to study protein interactions or as an antibody to study ligands or receptors. Diprotin A can be used in the pharmacological treatment of diseases such as cancer, inflammation, and pain.</p>Formule :C17H31N3O4Degré de pureté :Min. 95%Masse moléculaire :341.45 g/molH-VGLPISQ^R-OH
<p>Peptide H-VGLPISQ^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CNP-22 (Human, Porcine, Rat)
CAS :CNP-22 is a peptide that has been shown to activate ion channels, inhibit protein interactions, and bind to receptors. It has been used in research as an antibody activator, ligand inhibitor, and receptor antagonist. CNP-22 is a non-protein with a molecular weight of 714.Formule :C93H157N27O28S3Degré de pureté :Min. 95%Masse moléculaire :2,197.6 g/molMyelin PLP (139-151)
CAS :Myelin PLP (139-151) is a basic protein that belongs to the family of oligodendrocyte-myelin glycoproteins. It has been shown to activate toll-like receptor, which is a pattern recognition receptor that recognizes invading pathogens and triggers an immune response. Myelin PLP (139-151) may play a role in the development of autoimmune diseases, as it has been found to be a target for autoantibodies. It has also been shown to have antioxidative properties, which may help prevent free radical damage in the brain and other tissues. The monoclonal antibody against this protein can be used for immunohistological analysis.Formule :C72H104N20O17Degré de pureté :Min. 95%Masse moléculaire :1,521.72 g/molAc-TASSYFTNMFATWSPSKARL-NH2
Peptide Ac-TASSYFTNMFATWSPSKARL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Thr-Phe-Leu-Leu-Arg-NH2
CAS :<p>The endothelium is a layer of cells that lines the inner surface of blood vessels and lymphatic vessels, forming a barrier between circulating blood or lymph and the rest of the body. It is involved in maintaining vascular homeostasis as well as in inflammation. The endothelium regulates vascular tone and blood pressure through release of nitric oxide (NO) and other substances, such as prostacyclin, vasoactive peptides, endothelin-1, tumor necrosis factor-α, interleukin-1β, and thromboxane A2. Endothelial cells are activated by various means such as increased intracellular Ca2+ concentration or basic fibroblast growth factor (bFGF). This activation can be inhibited by receptor antagonists such as neurokinin-1 receptor antagonists.</p>Formule :C31H53N9O6Degré de pureté :Min. 95%Masse moléculaire :647.81 g/molBoc-D-Thr(Bzl)-OH
CAS :<p>Boc-D-Thr(Bzl)-OH is a peptide that is used as an activator or inhibitor of ion channels. It has been shown to inhibit the activity of L-type voltage dependent calcium channels and N-type voltage dependent sodium channels, as well as potassium channels. This peptide binds to the receptor site on the channel and blocks ion transport through the channel. Boc-D-Thr(Bzl)-OH can also be used to study protein interactions with receptors and ligands, as well as pharmacology.</p>Formule :C16H23NO5Degré de pureté :Min. 95%Masse moléculaire :309.36 g/molLL-37 amide
CAS :LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides.More recently, studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seen with vitamin D treatment for Covid-19.Formule :C205H341N61O52Masse moléculaire :4,493.3 g/molZ-Leu-Leu-Leu-H (aldehyde)
CAS :Z-Leu-Leu-Leu-H (aldehyde) is an inhibitor that binds to a receptor and prevents the binding of a ligand. This competitive inhibition is reversible and can be used as a research tool to study protein interactions. The high purity of this product makes it ideal for use in pharmacology, cell biology, and life science research.Formule :C26H41N3O5Degré de pureté :Min. 95%Masse moléculaire :475.62 g/molH-YARAAARQARAHPRNPARRTPGTRRGAPAA-NH2
Peptide H-YARAAARQARAHPRNPARRTPGTRRGAPAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-Lys(Cl-Z)-OH
CAS :<p>Boc-Lys(Cl-Z)-OH is a research tool that belongs to the group of peptides. It is an inhibitor of ion channels and can be used as a pharmacological agent. Boc-Lys(Cl-Z)-OH is an agonist of G protein coupled receptors, which are found on cell membranes. It may also be used to activate receptor tyrosine kinases. Boc-Lys(Cl-Z)-OH is a high purity product with > 99% purity.</p>Formule :C19H27N2O6ClDegré de pureté :Min. 95%Masse moléculaire :414.88 g/molCyclo(Arg-Gly-Asp-D-Phe-Cys)
CAS :<p>Cyclo(Arg-Gly-Asp-D-Phe-Cys) is a cyclic peptide that can form stable complexes with platinum. It has been shown to have anticancer activity against cervical cancer cells in tissue culture. Cyclo(Arg-Gly-Asp-D-Phe-Cys) binds to the integrin receptor on the surface of cancer cells, which leads to changes in redox potential, leading to cell death by apoptosis or necrosis. Cyclo(Arg-Gly-Asp-D-Phe-Cys) also has pharmacological properties that make it a good candidate for treatment of cancer.</p>Formule :C24H34N8O7SDegré de pureté :Min. 95%Masse moléculaire :578.65 g/molDSTYSLSSTLTLSK
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C64H107N15O26Masse moléculaire :1,616.64 g/molH-GTVGGYFL^AGR^-OH
Peptide H-GTVGGYFL^AGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Leu-Pro-Phe-Phe-Asp-NH2
CAS :<p>Ac-Leu-Pro-Phe-Phe-Asp-NH2 is a potential therapeutic for Alzheimer's disease. It has been shown to reduce the production of reactive oxygen species and inhibit the formation of amyloid beta oligomers. Ac-Leu-Pro-Phe-Phe-Asp-NH2 also reduces the frequency of protofibrils, which are aggregates that may play a role in Alzheimer's disease pathology. This peptide has been shown to have a protective effect on cell populations, which may lead to therapeutics that can delay or prevent Alzheimer's disease. Ac-Leu-Pro-Phe-Phe-Asp NH2 is an inhibitor of amyloid beta peptides and modulates their aggregation into protofibrils.</p>Formule :C35H46N6O8Degré de pureté :Min. 95%Masse moléculaire :678.89 g/molH-QTALVELVK^-OH
<p>Peptide H-QTALVELVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TASSYFTNMFATWSPSKARL-NH2
<p>Peptide H-TASSYFTNMFATWSPSKARL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FALPQYLK^-OH
<p>Peptide H-FALPQYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C49H74N10O11Masse moléculaire :979.18 g/molBoc-Cys(4-CH3Bzl)-OH
CAS :<p>Boc-Cys(4-CH3Bzl)-OH is a building block for the synthesis of peptides and other biologically active molecules. It is a protected amino acid that can be used in peptide synthesis, and it is commonly used as a building block for the synthesis of Boc-protected L-amino acids.</p>Formule :C16H23NO4SDegré de pureté :Min. 95%Masse moléculaire :325.42 g/molH-PQNLLLDPDTAVLK^-OH
<p>Peptide H-PQNLLLDPDTAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Chemotactic Peptide
CAS :<p>As a chemotactic peptide, For-Met-Leu-Phe (FMLP) has chemotactic properties, which means it can attract cells. For example it is a chemoattractant for phagocytic leukocytes and neutrophils. Neutrophils which have seven transmembrane G-protein coupled receptors are activated during the acute inflammatory response by FMLP and other chemotactic factors which bind to its surface receptors. This results in the activate of NF- κB, MAPK and PI3K pathways. In particular FMLP is known to induce Interleukin-8 (IL-8) which is responsible for both tissue damage and the pathogenesis of inflammatory processes resulting from neutrophils. Chemotactic peptide have been used to study the function of polymorphonuclear leukocytes and other white blood cells in inflammation. Chemotactic peptides are often used as fluorescent probes to measure intracellular metabolic responses to chemoattractant stimulation.<br>This product is available as a 0.5mg vial.</p>Formule :C21H31N3O5SDegré de pureté :Min. 95%Masse moléculaire :437.55 g/molH-Ala-Ala-Ala-pNA • HCl
CAS :<p>H-Ala-Ala-Ala-pNA • HCl is a porcine pancreatic elastase inhibitor. It is a chromogenic substrate that inhibits the proteolytic activity of elastase by binding to the active site and blocking its access to the peptide bond. H-Ala-Ala-Ala-pNA • HCl is used as an enzyme inhibitor in biochemistry and molecular biology research, and has been shown to inhibit enzymatic activity of human leukocyte elastase. The peptide is also a substrate for astacin, which cleaves it at the Cys residue.</p>Formule :C15H21N5O5•HClDegré de pureté :Min. 95%Masse moléculaire :387.83 g/molAc-VQIVYK-OH
Peptide Ac-VQIVYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDELLQSQIEK^-OH
<p>Peptide H-LDELLQSQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Myr-GSNK^SK^PK-NH2
<p>Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-K^CNTA^TCATQRLANFLVHSSNNFGAILSSTNVG^SNTY-NH2
<p>H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-LDLER^-OH
Peptide H-LDLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVDEVTIVNILTNR^-OH
Peptide H-GVDEVTIVNILTNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
