Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29729 produits trouvés pour "Peptides"
H-SLDFTELDVAAEK-OH
Peptide H-SLDFTELDVAAEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLDLDGIIAEVK-OH
Peptide H-SLDLDGIIAEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VKEFLESSPNTQWELR-OH
Peptide H-VKEFLESSPNTQWELR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CKILRHEDIHQQQD-OH
Peptide H-CKILRHEDIHQQQD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GGGDYKDDDDK-OH
Peptide H-GGGDYKDDDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLLGPHVLGV-OH
Peptide H-KLLGPHVLGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KKLLTQHFVQENYLEY-OH
Peptide H-KKLLTQHFVQENYLEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MKVLQEPTCVSDY-OH
Peptide H-MKVLQEPTCVSDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DRV^^YIHP^^F^^HL-OH
Peptide H-DRV^^YIHP^^F^^HL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Masse moléculaire :1,299.49 g/molH-ALPFGFILV-OH
Peptide H-ALPFGFILV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PGLYYF-OH
Peptide H-PGLYYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGRGKGGKGLGKGGAKRHRKV-OH
Peptide H-SGRGKGGKGLGKGGAKRHRKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ITTESIVIW-OH
Peptide H-ITTESIVIW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYIGSINNT-OH
Peptide H-SYIGSINNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLATQPPRTPPV-OH
Peptide H-SLATQPPRTPPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EVVLLVATEGR-OH
Peptide H-EVVLLVATEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVMSWAPPV-OH
Peptide H-VVMSWAPPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TVPWPNASL-OH
Peptide H-TVPWPNASL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGLPISQR-OH
Peptide H-VGLPISQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLTEIIASR-OH
Peptide H-VLTEIIASR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NVPER-OH
Peptide H-NVPER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VIGDQYVKV-OH
Peptide H-VIGDQYVKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WMHHNMDLI-OH
Peptide H-WMHHNMDLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SQLTKPISSLTKPYH-OH
Peptide H-SQLTKPISSLTKPYH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YKVVKIEPL-OH
Peptide H-YKVVKIEPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CTASNKNRGIIKTFS-OH
Peptide H-CTASNKNRGIIKTFS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YIPEITLPV-OH
Peptide H-YIPEITLPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KRRRCF-OH
Peptide H-KRRRCF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLKGPDIYKGVYQFKSVEFD-OH
Peptide H-GLKGPDIYKGVYQFKSVEFD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KWKLFKKIEKVGQRVRDAVISAGPAVATVAQATALAK-OH
Peptide H-KWKLFKKIEKVGQRVRDAVISAGPAVATVAQATALAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLQCVDLHV-OH
Peptide H-KLQCVDLHV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DRVYIHAF-OH
Peptide H-DRVYIHAF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIIAYTMSL-OH
Peptide H-SIIAYTMSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DTSPRHLSNVSSTGSI-OH
Peptide H-DTSPRHLSNVSSTGSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NTRPPLGNW-OH
Peptide H-NTRPPLGNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AAHTEDINACTLTTSPR-OH
Peptide H-AAHTEDINACTLTTSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVSEIQLMHNLGK-OH
Peptide H-SVSEIQLMHNLGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DREQAPNLVY-OH
Peptide H-DREQAPNLVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVGACGVGK-OH
Peptide H-VVGACGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AMKRHGLDNYRGYSL-OH
Peptide H-AMKRHGLDNYRGYSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RSDSGQQARY-OH
Peptide H-RSDSGQQARY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LQDVHNFVALGAPLAPR-OH
Peptide H-LQDVHNFVALGAPLAPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ESTD-OH
Peptide H-ESTD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ENREILKEPVHGVYY-OH
Peptide H-ENREILKEPVHGVYY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLAVTDSPAR-OH
Peptide H-VLAVTDSPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PGCAFLTV-OH
Peptide H-PGCAFLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPVVSGDTSPR-OH
Peptide H-SPVVSGDTSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELINNELSHFLEEIK-OH
Peptide H-ELINNELSHFLEEIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVEEVSLRK-OH
Peptide H-AVEEVSLRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLADEFIIPGLK-OH
Peptide H-VLADEFIIPGLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
