
Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29631 produits trouvés pour "Peptides"
Methionyl-Lysyl-Bradykinin (Human, Bovine)
CAS :Methionyl-Lysyl-Bradykinin is a peptide inhibitor that has been shown to inhibit the activity of protein kinase C (PKC). PKC is involved in a number of cellular functions, including the regulation of ion channels and the activation of other enzymes. Methionyl-Lysyl-Bradykinin can be used as an inhibitor in research tool experiments. It can also be used as an activator or ligand in receptor binding experiments. The high purity and specificity of this product make it suitable for use as a research reagent.Formule :C61H94N18O13SDegré de pureté :Min. 95%Masse moléculaire :1,319.6 g/molAzido-dPEG®12-NHS ester
CAS :Azido-dPEG®12-NHS ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®12-NHS ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formule :C16H34N4O7Degré de pureté :Min. 95%Masse moléculaire :394.46 g/molm-dPEG®23-OH
CAS :m-dPEG®23-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, m-dPEG®23-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.
Formule :C47H96O24Degré de pureté :Min. 95%Masse moléculaire :1,045.25 g/molNeurokinin B (Human, Porcine, Bovine, Rat, Mouse)
CAS :As a member of the tachykinin neuropeptide family, Neurokinin B is involved in the dilation of blood vessels, the contraction of smooth muscles and the excitation of neurons. This product can be applied as a NK3 receptors selective agonist and is available as a 0.5mg vial.
Formule :C55H79N13O14S2Degré de pureté :Min. 95%Masse moléculaire :1,210.4 g/molCoV-2 N (196 a.a)
A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV was found in the fish market at the city of Wuhan, Hubei province of China on December 2019. The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans. While bats are possibly the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus. The E. coli derived recombinant protein contains the Coronavirus 2019 middle region 196 a.a. from the nucleocapsid protein and fused to GST-6xHis tag at N-terminal and having a M.W. Of 48.4 kDa. It has been purified using PNTA Sepharose-Affinity Purification. The CoV-2 Nucleocapsid protein solution is supplied in 50mM Tris-HCl pH 8, 1M Urea, and 50% Glycerol.Degré de pureté :Min. 95%CBZ-N-Amido-dPEG®3-Amine
CAS :CBZ-N-Amido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. CBZ-N-Amido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formule :C25H53NO12Degré de pureté :Min. 95%Masse moléculaire :559.69 g/molm-dPEG®4-Tosylate
CAS :m-dPEG®4-Tosylate is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®4-Tosylate is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formule :C26H44N2O13Degré de pureté :Min. 95%Masse moléculaire :592.63 g/molNociceptin (Human)
CAS :Nociceptin is a peptide that binds to the NOP receptor and activates it, which inhibits neuronal activity. It has been shown to inhibit protein interactions by acting as an inhibitor of the enzyme proteasome. Nociceptin activates the Ligand-gated ion channels, which are involved in pain perception. Nociceptin also has been used as a research tool for investigating protein interactions and antibody production.
Formule :C79H129N27O22Degré de pureté :Min. 95%Masse moléculaire :1,809 g/molZ-Leu-Leu-Nva-H (aldehyde)
CAS :Z-Leu-Leu-Nva-H (aldehyde) is a peptide that has been used as an activator and an inhibitor of ion channels. It binds to the receptor site on the ion channel, which changes the flow of ions through the channel. This peptide has been shown to inhibit ligand binding and protein interactions. Z-Leu-Leu-Nva-H (aldehyde) is a high purity product that is available in bulk amounts.
Formule :C25H39N3O5Degré de pureté :Min. 95%Masse moléculaire :461.60 g/molAnti Total Glucagon (Human, Rat) Serum
Anti Total Glucagon (Human, Rat) Serum is a research tool that can be used in the study of ion channels and receptor-ligand interactions. It is a purified serum that contains glucagon. This product has been tested for purity and is used in the life science industry as a research tool to study protein interactions.Degré de pureté :Min. 95%Human-monoBiotin (PheB1)
Human-monoBiotin (PheB1) is a peptide that activates the acetylcholine receptor and may be used as an inhibitor for ion channels. This peptide has been shown to inhibit the binding of acetylcholine to its receptor, which may lead to therapeutic benefits for diseases associated with protein interactions, such as Alzheimer's disease. It also has a role in cell biology and pharmacology.Degré de pureté :Min. 95%Peptide YY (Rat, Mouse)-EIA Kit (1ea)
The Peptide YY (Rat, Mouse) EIA Kit is a research tool that can be used to detect peptides in rat and mouse samples. It is an immunoassay kit that detects the presence of peptide YY in rat and mouse samples. The assay has a high sensitivity and specificity for the detection of peptide YY. The kit contains all the necessary components for performing the test, including antibodies, buffers, standards and controls. The kit also contains a detailed protocol for performing the assay.Degré de pureté :Min. 95%Chromogranin A (Human)-EIA Kit (1ea)
Chromogranin A (CgA) is a peptide hormone found in the human body that is released from the cells of the pancreas and stomach. The CgA-EIA Kit is a solid phase enzyme immunoassay that can be used to measure CgA levels in human serum or plasma. Antibodies against CgA are coated onto a microtiter plate, and samples are added to the wells. After incubation, any CgA in the sample binds to the antibodies on the plate. The bound CgA is then detected using specific antibodies conjugated with horseradish peroxidase. The color reaction is measured at 450 nm with a reference wavelength of 630 nm.Degré de pureté :Min. 95%Fmoc-Amido-dPEG®24-Amido-dPEG®24-Acid
Fmoc-Amido-dPEG®24-Amido-dPEG®24-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-Amido-dPEG®24-Amido-dPEG®24-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formule :C117H214N2O53Degré de pureté :Min. 95%Masse moléculaire :2,496.96 g/molBrazzien (2-54)
Brazzien (2-54) is a peptide that binds to the extracellular domain of the human receptor for Advanced Glycation Endproducts (RAGE). This receptor plays an important role in many cellular processes, including tissue damage and inflammation. Brazzien (2-54) is a potent inhibitor of RAGE activity and has been shown to inhibit the binding of RAGE ligands to RAGE.Degré de pureté :Min. 95%Substance P (Human, Bovine, Rat, Mouse)
CAS :Substance P is a member of the tachykinin neuropeptide family which is produced in the central nervous system (CNS) and acts through its specific receptor neurokinin 1 receptor (NK-1R). NK-1R is present in neurons and on glial cell types. Substance P is involved in: pain perceptions as a neurotransmitter; gut motility; increased inflammation in the lungs, gastrointestinal tract and the skin and neuroinflammation. Interestingly the levels of Substance P are raised in inflammatory bowel diseases and through its involvement in cytokine release, it contributes to asthma pathology. These diverse selection of functions makes substance P a target for therapeutic research.Formule :C63H98N18O13S•3CH3COOH•5H2ODegré de pureté :Min. 95%Masse moléculaire :1,617.84 g/molAnti PTHrP (1-34)-NH₂, Human Serum
Anti PTHrP (1-34)-NH₂ is a peptide that belongs to the group of research tools. It is an activator of ion channels and has been shown to inhibit protein interactions. The CAS number is 6078-00-3, and the molecular weight is 7.5 kDa. Anti PTHrP (1-34)-NH₂ can be used as a pharmacological tool for studying the function of receptors and ligands, including those associated with cell biology and immunology.
Degré de pureté :Min. 95%TentaGel® B NH2 / Boc Resin (130 um)
TentaGel B resins represent a line of bifunctional resins that are useful for orthogonal synthesis. TentaGel is a gelatinous resin, an important support for solid phase synthesis. TentaGel resins are constructed with a backbone of low crosslinked polystyrene grafted with polyoxyethylene (polyethylene glycol). The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix. Particle size 130 µm; capacity: 02-03 meq/g Inside: NH2 Outside: BocDegré de pureté :Min. 95%Apolipoprotein E C-term Heavy Tryptic Peptide Standard (4nmol)
An apolipoprotein E C-term heavy tryptic peptide standard for use in protein identification and quantitation studies. As part of a fat-binding protein family, apolipoprotein E plays a role in the metabolism of fats in the body through interacting with the low density lipoprotein receptor, which is involved in the catabolism of triglyceride rich lipoproteins. Apolipoprotein E is also a major component in cholesterol metabolism and is a carrier of cholesterol in the brain. Additionally when forming a complex with C1q, apolipoprotein E is an inhibitor of the classical complement pathway. The N and C terminal regions of apolipoprotein are connected by a hinge region and the C-terminal region is a hydrophobic surface made up of three alpha helices and a low density lipoprotein receptor binding site.Degré de pureté :Min. 95%Putative orf1ab Polyprotein (3233-3247) [SARS Coronavirus]
Putative orf1ab Polyprotein (3233-3247) [SARS Coronavirus] is a high purity, recombinant protein that can be used as a research tool in cell biology, receptor pharmacology and biochemistry. It can also be used as an antibody to detect the presence of SARS coronavirus in cells. Putative orf1ab Polyprotein (3233-3247) [SARS Coronavirus] is an inhibitor of ion channels and ligand for receptor.
Degré de pureté :Min. 95%Anti Leptin (Rat) Serum
Anti Leptin (Rat) Serum is a peptide that is used as a research tool to activate the receptor. Anti Leptin (Rat) Serum has been shown to inhibit protein interactions and may be used in pharmacology to study the effects of leptin on ion channels. This antibody can be used for immunohistochemistry, Western blotting, and ELISA.Degré de pureté :Min. 95%Anti PTH (1-15) (Rat) Serum
Anti PTH (1-15) (Rat) Serum is a research tool that is used to study the activity of the parathyroid hormone. This product can be used as an activator or ligand in cell biology experiments. It has been shown to have a high affinity for the parathyroid hormone receptor and can be used to study protein interactions. Anti PTH (1-15) (Rat) Serum can also be used in pharmacological studies and may inhibit ion channels. This product has been shown to bind with peptides, which are small proteins, as well as antibodies and it may also inhibit protein synthesis.Degré de pureté :Min. 95%Azido-dPEG®12-TFP Ester
Azido-dPEG®12-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®12-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Degré de pureté :Min. 95%Masse moléculaire :791.78 g/molAlpha-Conotoxin MI
CAS :Alpha-conotoxin MI is a peptide toxin that binds to nicotinic acetylcholine receptors. Alpha-conotoxin MI is a high-purity, recombinant peptide that has been shown to be an activator of nicotinic acetylcholine receptors and inhibit the voltage-gated potassium channel. It may be used as a research tool in cell biology, pharmacology, and neuroscience.Formule :C58H88N22O17SDegré de pureté :Min. 95%Masse moléculaire :1,493.7 g/molHigh-Mobility Group Box 1, human, recombinant
HMGB1 is a protein that belongs to the family of high-mobility group box proteins. It is involved in regulating the release of inflammatory mediators and cytokines, such as IL-1β, IL-6, TNF-α and MCP-1. HMGB1 also plays a role in activation of neutrophils and macrophages. The recombinant form of HMGB1 has been shown to be an excellent research tool for studying protein interactions and receptor ligand interactions. High purity HMGB1 can be used as a pharmacological inhibitor or activator.
Degré de pureté :Min. 95%DBCO-TFP Ester
Please enquire for more information about DBCO-TFP Ester including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 90%Masse moléculaire :467.41 g/molC-Peptide (Rat)-EIA Kit (1ea)
C-Peptide (Rat)-EIA Kit is a kit that contains the necessary components for the quantitative determination of rat C-peptide in serum or plasma. The kit includes antibodies against rat C-peptide and a standard reference material. It is suitable for use with all commercially available ELISA readers.Degré de pureté :Min. 95%sTfR Light Tryptic Peptide Standard (4nmol)
A soluble transferrin receptor (sTfR) light tryptic peptide standard for protein identification and quantitation studies. sTfR is a cleaved extracellular segments of the transferrin receptor 1 and it can be used to measure the status of iron in the blood and thus help in studies into anemia, where iron is deficient.
Degré de pureté :Min. 95%Plectasin
A synthetic antimicrobial peptide whose sequence is derived from the Fungus, Pseudoplectania nigrella. This product has disulfide bonds between Cys4-Cys30, Cys15-Cys37, and Cys19-Cys39 and is available as a hydrochloride salt and as a 0.1mg vial. One letter code: GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCYFormule :C189H267N53O56S7Degré de pureté :Min. 95%Masse moléculaire :4,401.9 g/molL17E Cytosolic Delivery Peptide
CAS :Synthetic peptide toxin derivative of; M-lycotoxin from the Carolina wolf spider, Hogna carolinensis. This peptide can be used for transport into the cytoplasma and is available as a 0.5mg vial.
Formule :C134H220N38O31Degré de pureté :Min. 95%Masse moléculaire :2,859.4 g/molFollicle Stimulating Hormone, human, recombinant
Follicle stimulating hormone (FSH) is a glycoprotein that is secreted by the anterior pituitary gland. FSH stimulates follicular growth in the ovary and regulates the production of estrogen and progesterone. FSH can be used to treat infertility in women, as well as male hypogonadism. It can also be used for assisted reproduction techniques such as in vitro fertilization, gamete intrafallopian transfer, testicular sperm extraction, and ovarian hyperstimulation. FSH is synthesized from human recombinant DNA and is chromatographically purified with a freeze-dried process. Additives may include antibiotics to prevent bacterial contamination during production or storage. FSH has been shown to act synergistically with estradiol to promote follicular growth in ovaries of immature rats.Degré de pureté :Min. 95%monobiotin RLN2
Monobiotin is a monovalent cation that inhibits the binding of ATP. It is also a potent activator of the potassium ion channels, and has been used as a research tool for studying the effects of ion channels on cell growth and protein synthesis. Monobiotin has been shown to inhibit the binding of ATP to its receptor, thereby inhibiting protein synthesis in cells. Monobiotin is also an inhibitor of peptidases and can be used as an inhibitor in pharmacology studies. Monobiotin RLN2 is a high-purity monobiotin that does not contain any impurities or other proteins.Degré de pureté :Min. 95%Fmoc-N-Amido-dPEG®8-TFP Ester
Fmoc-N-Amido-dPEG®8-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®8-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formule :C40H49F4NO12Degré de pureté :Min. 95%Masse moléculaire :811.82 g/mol6-[D10]Leu-Glargine
Please enquire for more information about 6-[D10]Leu-Glargine including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%Alpha-1-Acid Glycoprotein Light Tryptic Peptide Standard (4nmol)
Alpha-1-Acid Glycoprotein light tryptic peptide standard for protein identification and quantitation. Alpha-1-Acid Glycoprotein is an acute phase protein whose concentration in serum increases during, infection, inflammation and tissue injury.Degré de pureté :Min. 95%FRETS-25Tyr (1 umol) (1umol)
FRETS-25Tyr (1 umol) (1umol) is a peptide that is used as a research tool for the study of protein interactions, receptor function, ion channels and ligand binding. FRETS-25Tyr (1 umol) (1umol) is an activator of protein kinase C and has been shown to inhibit ion channels. This peptide is also used in the study of cell biology, with an antibody that detects it. FRETS-25Tyr (1 umol) (1umol) has high purity and CAS No. 6058-57-2.Degré de pureté :Min. 95%Bromoacetamido-dPEG®24-Amido-DBCO
Bromoacetamido-dPEG®24-Amido-DBCO is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Bromoacetamido-dPEG®24-Amido-DBCO is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Degré de pureté :Min. 95%Masse moléculaire :1,525.6 g/molβ-Defensin-2, human
β-Defensin-2 is a protein that belongs to the class of defensins. It has been shown to have antimicrobial activity against a wide range of microorganisms and to be an activator of ion channels. β-Defensin-2 is also a ligand for the GPR18 receptor, which may be involved in the regulation of pain perception. β-Defensin-2 is purified from human leukocytes and has a purity of >98%.Formule :C188H305N55O50S6Degré de pureté :Min. 95%Masse moléculaire :4,328.2 g/molNPY, Human Antiserum
NPY is a peptide that is released by neurons and acts as an activator. It is also found in the central nervous system and regulates appetite, as well as other autonomic, behavioral, and endocrine functions. NPY has been shown to be an inhibitor of ion channels in the central nervous system. NPY has been shown to bind to receptors on the surface of cells, which are ligands for NPY. This binding activates or inhibits the receptor's signaling pathway. The CAS number for NPY is 1139-14-1 and it has a molecular weight of 9.6 kDa.END>
Degré de pureté :Min. 95%[D-Ala2,Met5]-Enkephalinamide
CAS :[D-Ala2,Met5]-Enkephalinamide is a peptide that belongs to the group of opioid peptides. It acts as an agonist and binds to the µ-opioid receptor. This receptor is involved in transmitting signals from outside the cell to inside the cell by regulating ion channels and controlling protein interactions. The binding of [D-Ala2,Met5]-Enkephalinamide to this receptor results in an inhibitory effect on neurotransmitter release, leading to a decrease of pain sensation. It has also been shown that [D-Ala2,Met5]-Enkephalinamide can act as an antagonist at other opioid receptors, such as the κ-opioid receptor.Formule :C28H38N6O6SDegré de pureté :Min. 95%Masse moléculaire :586.7 g/molTIMP1 Light Tryptic Peptide Standard (4nmol)
A TIMP1 Light Tryptic Peptide Standard for protein identification and quantitation studies. TIMP1, also known as TIMP metallopeptidase inhibitor 1 is an inhibitor of matrix metalloproteinases, which are enzymes that break down the extracellular matrix. It has also been associated with cell proliferation promotion and may have a role in apoptosis.Degré de pureté :Min. 95%Lys(1-Deoxyfructosyl)
CAS :Lys(1-Deoxyfructosyl) is a research tool used in cell biology and pharmacology. It interacts with many receptor types, such as ion channels, ligands, and antibodies. Lys(1-Deoxyfructosyl) binds to receptors and activates them. This leads to changes in the cells that are observed under a microscope. Lys(1-Deoxyfructosyl) has also been shown to inhibit protein interactions in living cells.Formule :C12H24N2O7Degré de pureté :Min. 95%Masse moléculaire :308.33 g/molCRF, Human Antiserum
CRF is a human antibody that is used as a research tool. It has reactivity with cells that are activated by CRF, and binds to the receptor on these cells. CRF is also known as a ligand, which can bind to the receptor and trigger changes in the cell, such as ion channels or protein interactions. CRF is an activator of G-protein coupled receptors.
Noggin Mouse
Noggin Mouse is a protein that is secreted by the mouse brain. It is a member of the transforming growth factor-beta superfamily and is involved in development, cell differentiation, and immune regulation. Noggin Mouse has been shown to inhibit cytokine production by E. coli and other bacterial strains. Noggin Mouse also inhibits the release of proinflammatory cytokines from macrophages and synoviocytes.
Degré de pureté :Min. 95%Argininamide
CAS :Argininamide is used in studies of the physicochemical characteristic of ligand binding DNA aptamers.Formule :C6H15N5ODegré de pureté :98%Couleur et forme :SolidMasse moléculaire :173.22cemadotin free base
CAS :Cemadotin free base(LU103793 free base) is a novel anti-limiting peptide , an analog of Dolastatin 15, a naturally occurring cytotoxic peptide that blocksFormule :C35H56N6O5Degré de pureté :98.70% - 99.64%Couleur et forme :SolidMasse moléculaire :640.86[Pyr3]-Amyloid β-Protein (3-42)
Catalogue peptide; min. 95% purityFormule :C196H299N53O55SMasse moléculaire :4,309.97 g/molOsteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat)
Catalogue peptide; min. 95% purityFormule :C27H41N9O8Masse moléculaire :619.7 g/molSomatostatin Tumor Inhibiting Analog
Catalogue peptide; min. 95% purityFormule :C54H70N11O10S2Masse moléculaire :1,097.4 g/molLeptin (22-56), human
Catalogue peptide; min. 95% purityFormule :C171H298N50O56Masse moléculaire :3,950.49 g/mol

