Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
29900 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Angiotensin II (1-4), human
Catalogue peptide; min. 95% purityFormule :C24H37N7O8Masse moléculaire :551.6 g/mol[D-Lys3]-GHRP-6
Catalogue peptide; min. 95% purityFormule :C49H63N13O6Masse moléculaire :930.13 g/molNecrofibrin, human
Catalogue peptide; min. 95% purityFormule :C67H112N16O25Masse moléculaire :1,541.73 g/molPancreatic Polypeptide (31-36) (human)
Catalogue peptide; min. 95% purity
Formule :C36H61N13O8Masse moléculaire :804 g/molPT-141
TFA salt. Catalogue peptide; min. 95% purityFormule :C50H68N14O10Masse moléculaire :1,025.20 g/molTransforming Growth Factor beta1 Peptide, TGF-beta1 (60-66), amide
Catalogue peptide; min. 95% purityFormule :C45H78N12O10Masse moléculaire :947.20 g/molLys-Bradykinin-Ser-Val-Gln-Val-Ser
Catalogue peptide; min. 95% purityFormule :C77H121N23O20Masse moléculaire :1,688.96 g/molIL-1b (208-240) (human)
Catalogue peptide; min. 95% purityFormule :C191H292N48O51SMasse moléculaire :4,108.81 g/mol[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Formule :C59H86N16O15Masse moléculaire :1,259.44 g/molC-terminal Proghrelin Isoform Peptide, mouse
Catalogue peptide; min. 95% purity
Formule :C50H86N22O17Masse moléculaire :1,267.38 g/molPrepro-adrenomedullin (153-185), human
Catalogue peptide; min. 95% purityFormule :C143H224N42O43Masse moléculaire :3,219.56 g/molMyosin Kinase Inhibiting Peptide
Catalogue peptide; min. 95% purityFormule :C40H78N18O11Masse moléculaire :987.2 g/molBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Formule :C72H122N21O29SMasse moléculaire :1,777.92 g/molAGRP (54-82)
Catalogue peptide; min. 95% purityFormule :C137H225N39O54Masse moléculaire :3,282.47 g/molSomatostatin-14 (3-10)
Catalogue peptide; min. 95% purity
Formule :C52H72N12O11SMasse moléculaire :1,073.28 g/molMSH Release Inhibiting Factor, amide
Catalogue peptide; min. 95% purityFormule :C13H24N4O3Masse moléculaire :284.36 g/molβ-Casein (90-96)
Catalogue peptide; min. 95% purityFormule :C103H175N35O27SMasse moléculaire :2,367.83 g/mol[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat
Catalogue peptide; min. 95% purityFormule :C143H226N46O39Masse moléculaire :3,213.6 g/molPre-S1 (12-32)
Catalogue peptide; min. 95% purity
Formule :C104H154N26O31SMasse moléculaire :2,296.61 g/molZ-Ala-Ala-Asn-AMC
CAS :Z-Ala-Ala-Asn-AMC is a molecule that is an analog of the amino acid alanine. It has been shown to be effective in inhibiting cancer cell viability and inducing apoptosis in MDA-MB-231 breast cancer cells, which can inhibit tumor growth. This molecule also inhibits protease activity, protein synthesis, and tubule cell proliferation. Z-Ala-Ala-Asn-AMC has applicability in the treatment of cancers and inflammatory diseases.Formule :C28H31N5O8Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :565.57 g/molForkhead derived peptide, Woodtide
Catalogue peptide; min. 95% purityFormule :C68H123N21O20SMasse moléculaire :1,586.93 g/mol[Ala18] Endothelin-1, human
Catalogue peptide; min. 95% purityFormule :C108H163N25O30S5Masse moléculaire :2,451.94 g/molSMCX (963-973) (human)
Catalogue peptide; min. 95% purityFormule :C48H81N13O18Masse moléculaire :1,128.26 g/mol[Pyr6]-Substance P (6-11)
Catalogue peptide; min. 95% purity
Formule :C36H49N7O7SMasse moléculaire :723.91 g/molbeta-Interleukin I (163-171), human
Catalogue peptide; min. 95% purityFormule :C39H64N12O19Masse moléculaire :1,005.01 g/molbeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formule :C216H371N75O59S6Masse moléculaire :5,155.22 g/mol[D-Ala2] Deltorphin II
Catalogue peptide; min. 95% purityFormule :C38H54N8O10Masse moléculaire :782.90 g/molβ-Amyloid (1-28)
Catalogue peptide; min. 95% purityFormule :C145H209N41O46Masse moléculaire :3,262.53 g/molbeta-Amyloid (30-16)
Catalogue peptide; min. 95% purityFormule :C86H126N24O21S2Masse moléculaire :1,896.22 g/molGRF, porcine
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formule :C219H365N73O66SMasse moléculaire :5,108.86 g/molDynorphin A (7-17), porcine
Catalogue peptide; min. 95% purityFormule :C65H108N22O16Masse moléculaire :1,453.72 g/molC. difficile Toxin B (529-536)
Catalogue peptide; min. 95% purityFormule :C48H71N13O15Masse moléculaire :1,070.18 g/molbeta II probe
Catalogue peptide; min. 95% purity
Formule :C94H150N26O31SMasse moléculaire :2,172.46 g/molSer-Ala-SAP-IIB
Catalogue peptide; min. 95% purityFormule :C42H71N13O14S2Masse moléculaire :1,046.24 g/mol[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Formule :C104H159N29O31Masse moléculaire :2,311.60 g/mol[Glu3,4,7,10,14]-Conantokin G
Catalogue peptide; min. 95% purityFormule :C83H137N25O35Masse moléculaire :2,045.16 g/molMMP-8 Substrate, fluorogenic
Catalogue peptide; min. 95% purityFormule :C49H63N13O13Masse moléculaire :1,042.14 g/molBoc-Gly-Arg-OH
CAS :Please enquire for more information about Boc-Gly-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C13H25N5O5Degré de pureté :Min. 95%Masse moléculaire :331.37 g/molHIV-1, HIV-2 Protease Substrate
Catalogue peptide; min. 95% purity
Formule :C56H80N12O14Masse moléculaire :1,145.3 g/molbeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Formule :C23H28N4O4Masse moléculaire :424.50 g/mol[D-Trp2] Met-Enkephalin, amide
Catalogue peptide; min. 95% purityFormule :C36H43N7O6SMasse moléculaire :701.85 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Formule :C197H317N59O54S3Masse moléculaire :4,472.26 g/molOrexin A (17-33) trifluoroacetate salt
CAS :Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesisFormule :C79H125N23O22Degré de pureté :Min. 95%Masse moléculaire :1,748.98 g/molDesmopressin
CAS :Produit contrôléDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formule :C46H64N14O12S2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,069.22 g/molAntioxidant peptide B
Catalogue peptide; min. 95% purity
Formule :C57H91N17O15Masse moléculaire :1,254.47 g/mol
![[D-Lys3]-GHRP-6](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00462.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00489.webp&w=3840&q=75)
![[Ala18] Endothelin-1, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00289.webp&w=3840&q=75)
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![[D-Ala2] Deltorphin II](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00826.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Glu3,4,7,10,14]-Conantokin G](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00410.webp&w=3840&q=75)
![[D-Trp2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00844.webp&w=3840&q=75)
