Peptides

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Fmoc-L-cysteic acid disodium including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg(NO2)-pNA·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH is a proteolytic inhibitor that inhibits the aspartic and hydrolytic enzymes. It has been shown to inhibit the activity of trypsin, pepsin, and elastase in human serum. This inhibitor also inactivates fibronectin by proteolysis. H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu OH has been shown to be specific for acidic proteases such as pepsin. The natural inhibitors of this peptide are Pro, Thr, Glu, Phe, Arg and Leu.

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesis

<p>Catalogue peptide; min. 95% purity</p>

<p>Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

H-Trp-Trp-OH is a reaction product of the amino acid tryptophan and various electron donors. The radical form of H-Trp-Trp-OH has been studied using 2D nuclear magnetic resonance (NMR) spectroscopy to determine its structure. In addition, H-Trp-Trp-OH has been used to study the mechanism of protein phosphorylation reactions. This chemical can be prepared from a solution of tryptophan in water and an oxidizing agent such as hydrogen peroxide or sodium hypochlorite. The frequency shift observed for H-Trp-Trp-OH was attributed to the presence of a constant that was found to be 10 Hz/M, indicating that this substance is a radical form. The sample preparation technique used in this experiment consisted of adding an equal volume of acetic acid to an unknown sample and then centrifuging it at 5000 rpm for five minutes before measuring its fluorescence emission.

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ile-Pro-OH is an experimental inhibitor of protein synthesis that has been shown to inhibit collagenase and pancreatic proteases. Z-Ile-Pro-OH inhibits the second order rate constant of hydrolysis by a kinetic method. The pH optimum of Z-Ile-Pro-OH is 7.5 and it does not hydrolyze at this pH. Z-Ile-Pro-OH binds to the active site of the protease, inhibiting its activity and has been shown to be non toxic in mice. The synthetic inhibitor has been used as a nutritional supplement for humans because it does not affect the pancreas or liver when ingested orally, but has no effect on bone growth.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Omega-Conotoxin MVIIC is a peptide toxin that blocks the voltage-dependent calcium channels. It has been shown to have neuroprotective properties and to inhibit glutamate induced neurotoxicity in vitro and in vivo. Omega-Conotoxin MVIIC inhibits neurotransmitter release by blocking the calcium channels and thereby reduces oxidative stress, which prevents neuronal cell death. This toxin also blocks the activity of voltage-dependent sodium channels, but its effects are not as potent as those on calcium channels. Omega-Conotoxin MVIIC has been found to be effective against cerebellar granule neurons, as well as other neurons in the brainstem, cerebellum, hippocampus, and cerebral cortex. The molecular weight of this toxin is approximately 10 kDa and it contains subunits (a total of eight).</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>