Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30316 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
beta-Endorphin (1-5), (16-31), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H173N27O29SMasse moléculaire :2,393.86 g/molHistone H3 (116-136), N15-39
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H197N39O30Masse moléculaire :2,570 g/molAcyl Carrier Protein (65-74) (acid)
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H74N12O16Masse moléculaire :1,063.18 g/molSMCY (950-960) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H85N15O18Masse moléculaire :1,172.31 g/molpp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H109N23O23Masse moléculaire :1,592.74 g/molAllatostatin VII
Catalogue peptide; min. 95% purityFormule :C46H69N13O13SMasse moléculaire :1,044.2 g/molAc-ACTH (1-14), 10-1-12A
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H111N21O21SMasse moléculaire :1,722.96 g/molOrn8, Urotensin II, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H85N13O18S2Masse moléculaire :1,376.60 g/molTNF-α (46-65) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C110H172N24O30Masse moléculaire :2,310.74 g/molbeta-Endorphin (27-31) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H45N7O9Masse moléculaire :623.71 g/molNTB (Naltriben)
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H65N11O11S2Masse moléculaire :1,060.29 g/molbeta-Amyloid (31-35)
<p>Catalogue peptide; min. 95% purity</p>Formule :C25H47N5O6SMasse moléculaire :545.75 g/mol[D-Phe7, D-Trp10]-Somatostatin 14 (7-14)
<p>Catalogue peptide; min. 95% purity</p>Masse moléculaire :1,049.3 g/molLeucokinin V
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H46N10O11Masse moléculaire :782.8 g/molXenopsin (XP)
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H73N13O10Masse moléculaire :980.20 g/molα-Conotoxin EI
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H123N27O27S5Masse moléculaire :2,091.39 g/molRS domain derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H85N25O15Masse moléculaire :1,204.33 g/molα-Casein (90-95)
<p>Catalogue peptide; min. 95% purity</p>Formule :C103H175N35O27SMasse moléculaire :2,367.83 g/molHPV-E6-N
<p>Catalogue peptide; min. 95% purity</p>Formule :C76H128N24O25SMasse moléculaire :1,810.07 g/molSynapsin I-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C53H91N21O14Masse moléculaire :1,246.45 g/molHIV-gp120-41-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C116H164N32O31SMasse moléculaire :2,534.86 g/molDok-5 (263-275)
<p>Catalogue peptide; min. 95% purity</p>Formule :C75H114N24O19Masse moléculaire :1,655.89 g/molHPV-E7-N
<p>Catalogue peptide; min. 95% purity</p>Formule :C108H159N23O39S2Masse moléculaire :2,467.72 g/molPDGFRtide
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H76N10O20Masse moléculaire :1,185.26 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
<p>Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MMP Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C45H64N14O11Masse moléculaire :977.1 g/molAdrenomedullin (1-52), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C264H406N80O77S3Masse moléculaire :6,028.72 g/molMastoparan 7
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H124N18O15Masse moléculaire :1,421.85 g/molBrain Derived Acidic Fibroblast Growth Factor (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H95N15O15Masse moléculaire :1,290.53 g/molMLC-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C70H115N25O17Masse moléculaire :1,578.85 g/molBiotin-Glucagon-Like Peptide 1 (7-36), amide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C159H240N42O47Masse moléculaire :3,524.00 g/molLMP1 (156-164), IAL
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H81N13O14Masse moléculaire :1,148.34 g/mol[Des-Tyr1]-g-Endorphin
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H122N18O25SMasse moléculaire :1,695.97 g/molRC-160(Vapreotide)
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H70N12O9S2Masse moléculaire :1,131.4 g/molP60c-src Substrate II, Phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H45N6O12PMasse moléculaire :748.8 g/molMMP-7 Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C52H77N17O14Masse moléculaire :1,164.31 g/molBiotin-CRF (human, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C218H358N62O65S3Masse moléculaire :4,983.85 g/mol[Des-Tyr1]-beta-Endorphin, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C149H242N38O44SMasse moléculaire :3,301.88 g/molCalpain Inhibitor Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C140H227N35O44SMasse moléculaire :3,136.64 g/molPKCe pseudosubstrate derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H155N39O21SMasse moléculaire :2,067.47 g/molα-CGRP (19-37), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H137N25O25Masse moléculaire :1,921.20 g/mol[D-Ala2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H38N6O6SMasse moléculaire :586.72 g/molPAR-1-selective peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H58N10O9Masse moléculaire :762.91 g/molbeta-Bag Cell Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H53N13O6Masse moléculaire :727.87 g/molPro-Adrenomedullin N20, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H178N36O26Masse moléculaire :2,444.83 g/molCalcitonin C-terminal Adjacent Peptide, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C82H117N23O27SMasse moléculaire :1,889.05 g/molbeta-Lipotropin (1-10), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H66N10O15Masse moléculaire :951.05 g/mol[Leu144]-PLP (139-151), L144-PLP(139-151)
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H105N19O17Masse moléculaire :1,448.70 g/mol[Tyr12]-Somatostatin-28 (1-14)
<p>Catalogue peptide; min. 95% purity</p>Formule :C65H107N23O20SMasse moléculaire :1,562.78 g/mol
![[D-Phe7, D-Trp10]-Somatostatin 14 (7-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00141.webp&w=3840&q=75)
![[Des-Tyr1]-g-Endorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00421.webp&w=3840&q=75)
![[Des-Tyr1]-beta-Endorphin, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00420.webp&w=3840&q=75)
![[D-Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00838.webp&w=3840&q=75)
![[Leu144]-PLP (139-151), L144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00494.webp&w=3840&q=75)
![[Tyr12]-Somatostatin-28 (1-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00705.webp&w=3840&q=75)