Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30316 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Leucopyrokinin (LPK)
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H66N12O12Masse moléculaire :931.06 g/molMARCKS Protein (151-175)
<p>Catalogue peptide; min. 95% purity</p>Formule :C147H243N41O31Masse moléculaire :3,080.83 g/molRC-160(Vapreotide)
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H70N12O9S2Masse moléculaire :1,131.4 g/mol[Des-Tyr1]-g-Endorphin
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H122N18O25SMasse moléculaire :1,695.97 g/molLMP1 (156-164), IAL
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H81N13O14Masse moléculaire :1,148.34 g/molBiotin-Glucagon-Like Peptide 1 (7-36), amide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C159H240N42O47Masse moléculaire :3,524.00 g/molMLC-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C70H115N25O17Masse moléculaire :1,578.85 g/molBrain Derived Acidic Fibroblast Growth Factor (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H95N15O15Masse moléculaire :1,290.53 g/molMastoparan 7
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H124N18O15Masse moléculaire :1,421.85 g/moln-Decyltetraoxyethylene
CAS :<p>N-Decyltetraoxyethylene is a fatty acid that can be synthesized by reacting naphthalene with ethylene oxide. It is used as a surfactant in pharmaceutical preparations and has been shown to have affinity for ligands such as anionic and cationic surfactants, fatty acids, and model proteins. N-Decyltetraoxyethylene also has antiviral properties, binding to influenza virus particles. This compound has been shown to exhibit bronchiolitis obliterans when administered to animals in vivo. The particle size of this compound is too small for it to be used as a respiratory inhalant drug, but the high surface area of the molecule allows it to be used as a nasal or eye drug.</p>Formule :C18H38O5Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :334.49 g/molPlatelet-Derived Growth Factor Receptor Substrate 2
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H86N13O22PMasse moléculaire :1,300.36 g/mol[Ala4]-MBP (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H81N21O17Masse moléculaire :1,236.32 g/molHuman IgE Pentapeptide HEPP
<p>Catalogue peptide; min. 95% purity</p>Formule :C22H36N8O11Masse moléculaire :588.58 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Lys-Lys-Lys-Lys-OH trifluoroacetate salt
CAS :Agonist of toll-like receptors TLR1/2Formule :C81H156N10O13SDegré de pureté :Min. 95%Masse moléculaire :1,510.23 g/molHIV-gp41-Antigenic Peptide 5
<p>Catalogue peptide; min. 95% purity</p>Formule :C184H282N56O53S2Masse moléculaire :4,190.77 g/molWWamide-3
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H66N12O9SMasse moléculaire :963.18 g/molAc-D-Lys-OH
CAS :Nicotinamide is a form of vitamin B3 that has been shown to inhibit the growth of Giardia lamblia trophozoites. Nicotinamide also inhibits the sirtuins and has been shown to inhibit cell cycle control in microorganisms. It inhibits transcriptional activity by competing with nicotinamide adenine dinucleotide for binding sites on DNA and prevents the formation of nicotinamide-adenine dinucleotide complexes, which are needed for DNA synthesis. Nicotinamide also binds to metronidazole, causing it to be inactive as an antimicrobial agent. The mechanism of action of nicotinamide may be due to its ability to bind and inactivate metronidazole, thereby preventing it from functioning as an anti-microbial agent.Formule :C8H16N2O3Degré de pureté :Min. 95%Masse moléculaire :188.22 g/molAntioxidant peptide B
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H91N17O15Masse moléculaire :1,254.47 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C197H317N59O54S3Masse moléculaire :4,472.26 g/molMyristoyl-Lys-Arg-Thr-Leu-Arg-OH
CAS :<p>Myristoyl-Lys-Arg-Thr-Leu-Arg-OH is a synthetic compound that interacts with tyrosine kinase substrate proteins. It inhibits the activation of these proteins and prevents the phosphorylation of tyrosine residues in other substrate proteins. Myristoyl-Lys-Arg-Thr-Leu-Arg-OH has been shown to have potent inhibitory activity against IL2 receptor and adriamycin, which are protein kinases that play important roles in the death pathway.</p>Formule :C42H82N12O8Degré de pureté :Min. 95%Masse moléculaire :883.18 g/mol[D-Trp2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C36H43N7O6SMasse moléculaire :701.85 g/molbeta-Casomorphin (1-3) amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C23H28N4O4Masse moléculaire :424.50 g/molHIV-1, HIV-2 Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H80N12O14Masse moléculaire :1,145.3 g/mol4-Alkoxybenzyl alcohol resin (100-200 mesh)
CAS :4-Alkoxybenzyl alcohol resin is a fine chemical that has been shown to be useful as a scaffold for the synthesis of complex compounds. It is soluble in common organic solvents, such as ethanol and acetone, and can be used as a reaction component for the synthesis of speciality chemicals. This product is also an intermediate for research chemicals, which can be synthesized by reacting 4-alkoxybenzyl alcohol with different reagents. The high quality of this product makes it ideal for use in the synthesis of other compounds and reactions.Couleur et forme :PowderMMP-8 Substrate, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H63N13O13Masse moléculaire :1,042.14 g/molQuinupristin
CAS :Quinupristin, a macrolide-lincosamide-streptogramin antibiotic, inhibits protein synthesis in bacteria.Formule :C53H67N9O10SDegré de pureté :98.05% - 98.16%Couleur et forme :SolidMasse moléculaire :1022.22H-Ser-Glu-OH
CAS :<p>H-Ser-Glu-OH is a carbohydrate. It has been shown to be involved in the diagnosis of pancreatic cancer by binding to the peptide transporter and inhibiting its function. H-Ser-Glu-OH binds to a number of chemotactic proteins that are involved in the inflammatory response. This interaction may lead to degranulation and lysosome release, which could cause an increase in cancer cells. The carbohydrate ligand on H-Ser-Glu-OH is acidic and has functional groups that allow it to interact with other molecules in a way that is not possible for monosaccharides.</p>Formule :C8H14N2O6Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :234.21 g/mol[Glu3,4,7,10,14]-Conantokin G
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H137N25O35Masse moléculaire :2,045.16 g/mol[Tyr27]-pTH (27-48) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C104H159N29O31Masse moléculaire :2,311.60 g/molSer-Ala-SAP-IIB
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H71N13O14S2Masse moléculaire :1,046.24 g/molbeta II probe
<p>Catalogue peptide; min. 95% purity</p>Formule :C94H150N26O31SMasse moléculaire :2,172.46 g/molC. difficile Toxin B (529-536)
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H71N13O15Masse moléculaire :1,070.18 g/molLL-37, Antimicrobial Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C205H340N60O53Masse moléculaire :4,493.37 g/molDynorphin A (7-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C65H108N22O16Masse moléculaire :1,453.72 g/molGRF, porcine
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formule :C219H365N73O66SMasse moléculaire :5,108.86 g/molbeta-Amyloid (30-16)
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H126N24O21S2Masse moléculaire :1,896.22 g/molbeta-Amyloid (1-28)
<p>Catalogue peptide; min. 95% purity</p>Formule :C145H209N41O46Masse moléculaire :3,262.53 g/mol[D-Ala2] Deltorphin II
<p>Catalogue peptide; min. 95% purity</p>Formule :C38H54N8O10Masse moléculaire :782.90 g/molbeta-Defensin-3, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C216H371N75O59S6Masse moléculaire :5,155.22 g/molSuccinyl-(Glu9,Ala11·15)-Endothelin-1 (8-21)
CAS :Sovateltide is a peptide that is composed of 21 amino acids. It is an agonist of the endothelin receptors ET A and ET B. Succinyl-(Glu9,Ala11·15)-Endothelin (8,21) Sovateltide has been shown to be neuroprotective in preclinical studies and may have potential as a therapeutic agent for the treatment of radiation damage to the brain.Formule :C86H117N17O27Degré de pureté :Min. 95%Masse moléculaire :1,820.95 g/molDynorphin A (1-11), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H103N21O13Masse moléculaire :1,362.66 g/molbeta-Interleukin I (163-171), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C39H64N12O19Masse moléculaire :1,005.01 g/mol[Pyr6]-Substance P (6-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C36H49N7O7SMasse moléculaire :723.91 g/molSMCX (963-973) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H81N13O18Masse moléculaire :1,128.26 g/molDABCYL-TNF-alpha-EDANS (-4 to +6) (human) trifluoroacetate salt
CAS :<p>DABCYL-TNF-alpha-EDANS (-4 to +6) (human) trifluoroacetate salt is a fine chemical that has been shown to be useful in research. It is a versatile building block for the synthesis of complex compounds and can be used as a reaction component for the synthesis of speciality chemicals. The compound is a high quality reagent, which can be used as an intermediate for the synthesis of other chemical compounds.</p>Formule :C70H104N22O18S·C2HF3O2Degré de pureté :Min. 95%Couleur et forme :Red SolidMasse moléculaire :1,687.8 g/molForkhead derived peptide, Woodtide
<p>Catalogue peptide; min. 95% purity</p>Formule :C68H123N21O20SMasse moléculaire :1,586.93 g/molPre-S1 (12-32)
<p>Catalogue peptide; min. 95% purity</p>Formule :C104H154N26O31SMasse moléculaire :2,296.61 g/mol[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C143H226N46O39Masse moléculaire :3,213.6 g/molBoc-N-Me-D-Tyr-OH·DCHA
CAS :Produit contrôléPlease enquire for more information about Boc-N-Me-D-Tyr-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C15H21NO5·C12H23NDegré de pureté :Min. 95%Masse moléculaire :476.65 g/molR-G-D-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C15H26N7O7S1Masse moléculaire :448.48 g/mol
![[Des-Tyr1]-g-Endorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00421.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[D-Trp2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00844.webp&w=3840&q=75)
![[Glu3,4,7,10,14]-Conantokin G](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00410.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[D-Ala2] Deltorphin II](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00826.webp&w=3840&q=75)
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00489.webp&w=3840&q=75)
