Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30318 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
HIV-gp120-41-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C116H164N32O31SMasse moléculaire :2,534.86 g/molDok-5 (263-275)
<p>Catalogue peptide; min. 95% purity</p>Formule :C75H114N24O19Masse moléculaire :1,655.89 g/molHPV-E7-N
<p>Catalogue peptide; min. 95% purity</p>Formule :C108H159N23O39S2Masse moléculaire :2,467.72 g/molPDGFRtide
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H76N10O20Masse moléculaire :1,185.26 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
<p>Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MMP Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C45H64N14O11Masse moléculaire :977.1 g/molAdrenomedullin (1-52), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C264H406N80O77S3Masse moléculaire :6,028.72 g/molFibrinopeptide B
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H93N19O25Masse moléculaire :1,552.60 g/molSturgeon F
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H83N13O14SMasse moléculaire :1,254.48 g/molMastoparan 7
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H124N18O15Masse moléculaire :1,421.85 g/molBrain Derived Acidic Fibroblast Growth Factor (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H95N15O15Masse moléculaire :1,290.53 g/molMLC-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C70H115N25O17Masse moléculaire :1,578.85 g/molBiotin-Glucagon-Like Peptide 1 (7-36), amide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C159H240N42O47Masse moléculaire :3,524.00 g/molLMP1 (156-164), IAL
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H81N13O14Masse moléculaire :1,148.34 g/mol[Des-Tyr1]-g-Endorphin
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H122N18O25SMasse moléculaire :1,695.97 g/molRC-160(Vapreotide)
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H70N12O9S2Masse moléculaire :1,131.4 g/molP60c-src Substrate II, Phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H45N6O12PMasse moléculaire :748.8 g/molMMP-7 Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C52H77N17O14Masse moléculaire :1,164.31 g/molBiotin-CRF (human, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C218H358N62O65S3Masse moléculaire :4,983.85 g/mol[Des-Tyr1]-beta-Endorphin, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C149H242N38O44SMasse moléculaire :3,301.88 g/molCalpain Inhibitor Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C140H227N35O44SMasse moléculaire :3,136.64 g/molPKCe pseudosubstrate derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H155N39O21SMasse moléculaire :2,067.47 g/molα-CGRP (19-37), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H137N25O25Masse moléculaire :1,921.20 g/mol[D-Ala2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H38N6O6SMasse moléculaire :586.72 g/molPAR-1-selective peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H58N10O9Masse moléculaire :762.91 g/molbeta-Bag Cell Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H53N13O6Masse moléculaire :727.87 g/molPro-Adrenomedullin N20, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H178N36O26Masse moléculaire :2,444.83 g/molCalcitonin C-terminal Adjacent Peptide, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C82H117N23O27SMasse moléculaire :1,889.05 g/molbeta-Lipotropin (1-10), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H66N10O15Masse moléculaire :951.05 g/mol[Leu144]-PLP (139-151), L144-PLP(139-151)
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H105N19O17Masse moléculaire :1,448.70 g/mol[Tyr12]-Somatostatin-28 (1-14)
<p>Catalogue peptide; min. 95% purity</p>Formule :C65H107N23O20SMasse moléculaire :1,562.78 g/molα-Melanocyte Stimulating Hormone [Acetyl-D-Lys11, D-Val13] (11-13) (MSHa)
<p>Catalogue peptide; min. 95% purity</p>Formule :C18H33N5O4Masse moléculaire :383.49 g/molPACAP-38, amide, frog
<p>Catalogue peptide; min. 95% purity</p>Formule :C204H333N63O53SMasse moléculaire :4,548.38 g/molParallel topology beta-Amyloid modified peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C151H211N37O39SMasse moléculaire :3,199.65 g/molIL-8ra (9-29)
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H150N24O38S2Masse moléculaire :2,504.71 g/molAc-beta-Endorphin, bovine, camel, ovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H252N42O45SMasse moléculaire :3,479.99 g/molMARCKS Protein (151-175)
<p>Catalogue peptide; min. 95% purity</p>Formule :C147H243N41O31Masse moléculaire :3,080.83 g/molLeucopyrokinin (LPK)
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H66N12O12Masse moléculaire :931.06 g/molPrepro VIP (111-122) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C53H87N13O21Masse moléculaire :1,242.36 g/molγ-TAC4 (32-50)
<p>Catalogue peptide; min. 95% purity</p>Formule :C92H146N24O31Masse moléculaire :2,084.33 g/molPhosphatase Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H65N12O11PMasse moléculaire :836.95 g/mol[D-Ala2]-beta-Casomorphin (1-3) amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C21H26N4O4Masse moléculaire :398.47 g/molα-Casomorphin (1-2)
<p>Catalogue peptide; min. 95% purity</p>Formule :C14H18N2O4Masse moléculaire :278.31 g/molProlactin Releasing Peptide (1-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H244N54O41SMasse moléculaire :3,576.01 g/molErythromycin resistance peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C31H52N8O6SMasse moléculaire :664.86 g/molTNF-α(71-82), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H91N19O18Masse moléculaire :1,258.41 g/molADP-Ribosylation Factor 1, ARF1 (2-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C85H131N21O21Masse moléculaire :1,783.12 g/molMAP Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C101H172N30O32Masse moléculaire :2,318.66 g/mol(D-His(Bzl)6)-LHRH (1-7) (free acid)
CAS :<p>Please enquire for more information about (D-His(Bzl)6)-LHRH (1-7) (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C53H62N12O11Degré de pureté :Min. 95%Masse moléculaire :1,043.13 g/mol
![[Des-Tyr1]-g-Endorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00421.webp&w=3840&q=75)
![[Des-Tyr1]-beta-Endorphin, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00420.webp&w=3840&q=75)
![[D-Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00838.webp&w=3840&q=75)
![[Leu144]-PLP (139-151), L144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00494.webp&w=3840&q=75)
![[Tyr12]-Somatostatin-28 (1-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00705.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone [Acetyl-D-Lys11, D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00016.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-3) amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00827.webp&w=3840&q=75)
