Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30318 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
TNF-α (46-65) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C110H172N24O30Masse moléculaire :2,310.74 g/molbeta-Endorphin (27-31) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H45N7O9Masse moléculaire :623.71 g/molNTB (Naltriben)
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H65N11O11S2Masse moléculaire :1,060.29 g/molbeta-Amyloid (31-35)
<p>Catalogue peptide; min. 95% purity</p>Formule :C25H47N5O6SMasse moléculaire :545.75 g/mol[D-Phe7, D-Trp10]-Somatostatin 14 (7-14)
<p>Catalogue peptide; min. 95% purity</p>Masse moléculaire :1,049.3 g/molLeucokinin V
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H46N10O11Masse moléculaire :782.8 g/molXenopsin (XP)
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H73N13O10Masse moléculaire :980.20 g/molα-Conotoxin EI
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H123N27O27S5Masse moléculaire :2,091.39 g/molHPV-E7-N
<p>Catalogue peptide; min. 95% purity</p>Formule :C108H159N23O39S2Masse moléculaire :2,467.72 g/molPDGFRtide
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H76N10O20Masse moléculaire :1,185.26 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
<p>Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MMP Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C45H64N14O11Masse moléculaire :977.1 g/molAdrenomedullin (1-52), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C264H406N80O77S3Masse moléculaire :6,028.72 g/molCalpain Inhibitor Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C140H227N35O44SMasse moléculaire :3,136.64 g/molPKCe pseudosubstrate derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H155N39O21SMasse moléculaire :2,067.47 g/molα-CGRP (19-37), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H137N25O25Masse moléculaire :1,921.20 g/mol[D-Ala2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H38N6O6SMasse moléculaire :586.72 g/molPAR-1-selective peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H58N10O9Masse moléculaire :762.91 g/molbeta-Bag Cell Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H53N13O6Masse moléculaire :727.87 g/molKinase Domain of Insulin Receptor (2)
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H108N19O27PMasse moléculaire :1,702.77 g/molGLP-2 (1-33) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C165H254N44O55SMasse moléculaire :3,766.1 g/molbeta-Casomorphin (1-5) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C30H37N5O7Masse moléculaire :579.66 g/molGalanin-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C155H237N46O46SMasse moléculaire :3,511.95 g/molF1 Peptide, lobster
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H75N17O11Masse moléculaire :1,066.24 g/molIL-8 Inhibitor
CAS :IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys-Arg-NH2 is a molecule that blocks the receptor for IL-8, a c-c chemokine. This leads to reduced inflammation and decreased activation of cells in the inflammatory process. IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys--Arg--NH2 has been shown to be effective in reducing chronic bronchitis and pancreatitis in animal models. The effective dose for IL 8 inhibitor is not yet known.Formule :C45H66N18O7SDegré de pureté :Min. 95%Masse moléculaire :1,003.19 g/molMARCKS PSD-Derived Peptide, PKC Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C75H122N20O15Masse moléculaire :1,543.93 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H110N20O17Masse moléculaire :1,467.75 g/molbeta-Amyloid (16-20)
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H52N6O6Masse moléculaire :652.84 g/molMyristoylated ADP-Ribosylation Factor 1, myr-ARF1 (2-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C99H157N21O22Masse moléculaire :1,993.49 g/mol[Met5, Lys6, Arg7] a-Neo-Endorphin (1-7)
<p>Catalogue peptide; min. 95% purity</p>Formule :C39H59N11O9SMasse moléculaire :858.04 g/mol2B-(S)
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H138N28O29SMasse moléculaire :2,000.24 g/mol[Pro18, Asp21] beta-Amyloid (17-21), iAb5
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H43N5O8Masse moléculaire :637.74 g/molAcetalin 3, Opioid Receptor Antagonist 3
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H61N114O8S2Masse moléculaire :912.15 g/mol2A/2B Dengue Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C39H68N16O11Masse moléculaire :937.08 g/molp60c-src Substrate I
Catalogue peptide; min. 95% purityFormule :C44H60N8O11Masse moléculaire :877.01 g/mol[D-Pro2]-beta-Casomorphin (1-5) ,bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C30H37N5O7Masse moléculaire :579.66 g/molGIP, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C226H343N61O66SMasse moléculaire :5,002.69 g/mol[Ala9,10, Lys11,12] Glycogen Synthase (1-12)
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H103N17O16Masse moléculaire :1,270.7 g/molAmyloid beta-Protein (6-20)
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H119N23O23Masse moléculaire :1,843.05 g/molPDGF beta-Receptor (739-746) (phosphorylated)
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H62N9O18PSMasse moléculaire :1,116.14 g/mol[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H67N9O12Masse moléculaire :890.06 g/molBiotin-PACAP (1-38), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C203H331N63O53S1Masse moléculaire :4,534.24 g/mol[D-Tyr11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Formule :C78H121N21O20Masse moléculaire :1,673 g/molP75-TNFR Fragment
<p>Catalogue peptide; min. 95% purity</p>Formule :C53H85N15O15SMasse moléculaire :1,204.42 g/molA-18-F-NH2
<p>Catalogue peptide; min. 95% purity</p>Formule :C89H130N24O24Masse moléculaire :7,488 g/molRES-701-1
<p>Catalogue peptide; min. 95% purity</p>Formule :C103H117N23O24Masse moléculaire :2,061.22 g/molH-Arg(Pbf)-OtBu·HCl
CAS :<p>Please enquire for more information about H-Arg(Pbf)-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C23H38N4O5S·HClDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :519.1 g/molbeta-Casomorphin (1-4) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H34N4O6Masse moléculaire :522.61 g/molFmoc-Homoarg (Z)2-OH
CAS :<p>Please enquire for more information about Fmoc-Homoarg (Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C38H38N4O8Degré de pureté :Min. 95%Masse moléculaire :678.73 g/molHPV-E6-M
<p>Catalogue peptide; min. 95% purity</p>Formule :C111H151N25O37SMasse moléculaire :2,459.64 g/mol
![[D-Phe7, D-Trp10]-Somatostatin 14 (7-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00141.webp&w=3840&q=75)
![[D-Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00838.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![[Met5, Lys6, Arg7] a-Neo-Endorphin (1-7)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00876.webp&w=3840&q=75)
![[Pro18, Asp21] beta-Amyloid (17-21), iAb5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00575.webp&w=3840&q=75)
![[D-Pro2]-beta-Casomorphin (1-5) ,bovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00843.webp&w=3840&q=75)
![[Ala9,10, Lys11,12] Glycogen Synthase (1-12)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00635.webp&w=3840&q=75)
![[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00513.webp&w=3840&q=75)
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
