Peptides

<p>Please enquire for more information about Z-Asu (OtBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DABCYL-TNF-alpha-EDANS (-4 to +6) (human) trifluoroacetate salt is a fine chemical that has been shown to be useful in research. It is a versatile building block for the synthesis of complex compounds and can be used as a reaction component for the synthesis of speciality chemicals. The compound is a high quality reagent, which can be used as an intermediate for the synthesis of other chemical compounds.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-Phe-Val-OH, also known as humanized Val-Phe-His-Leu (VHL), is a monoclonal antibody that binds to the antigen epidermal growth factor (EGF). It has been shown to have diagnostic and therapeutic properties in vitro. This antibody is used in the diagnosis of cancer tissues and is able to identify carcinoma cell lines. Furthermore, it can be used to diagnose hepatitis C virus infection. H-Phe-Val-OH blocks the binding of EGF with its receptor on the surface of cells and prevents the proliferation of cancerous cells. It also inhibits cancer growth by reducing the synthesis of proteins such as epidermal growth factor and transforming growth factor alpha.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-Ser-Glu-OH is a carbohydrate. It has been shown to be involved in the diagnosis of pancreatic cancer by binding to the peptide transporter and inhibiting its function. H-Ser-Glu-OH binds to a number of chemotactic proteins that are involved in the inflammatory response. This interaction may lead to degranulation and lysosome release, which could cause an increase in cancer cells. The carbohydrate ligand on H-Ser-Glu-OH is acidic and has functional groups that allow it to interact with other molecules in a way that is not possible for monosaccharides.</p>

<p>4-Alkoxybenzyl alcohol resin is a fine chemical that has been shown to be useful as a scaffold for the synthesis of complex compounds. It is soluble in common organic solvents, such as ethanol and acetone, and can be used as a reaction component for the synthesis of speciality chemicals. This product is also an intermediate for research chemicals, which can be synthesized by reacting 4-alkoxybenzyl alcohol with different reagents. The high quality of this product makes it ideal for use in the synthesis of other compounds and reactions.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Myristoyl-Lys-Arg-Thr-Leu-Arg-OH is a synthetic compound that interacts with tyrosine kinase substrate proteins. It inhibits the activation of these proteins and prevents the phosphorylation of tyrosine residues in other substrate proteins. Myristoyl-Lys-Arg-Thr-Leu-Arg-OH has been shown to have potent inhibitory activity against IL2 receptor and adriamycin, which are protein kinases that play important roles in the death pathway.</p>

<p>Please enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Z-Gly-Pro-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Seglitide is a cyclic peptide that is a model system for the receptor activity of somatostatin. Somatostatin inhibits cells by binding to its receptors, which are found on the surface of endocrine cells and in the hypothalamus. Seglitide has been shown to inhibit cell growth in tissue culture and is a potent inhibitor of epidermal growth factor (EGF) production. Seglitide also activates locomotor activity in mice, suggesting that it may have some clinical relevance. Structural analysis has revealed that seglitide's amino acid sequence is similar to somatostatin's, making them closely related compounds. It also binds to DNA-dependent RNA polymerase, preventing transcription and replication.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Fmoc-Leu-Gly-OH is a dipeptide that is reversibly soluble in water and organic solvents. It has been found to be stable at millimeter and nanometer scales, which makes it suitable for use as a hydrogel or fiber. Fmoc-Leu-Gly-OH has also been shown to form membranes of variable thickness (from micrometers to nanometers) that are sensitive to pH changes. This means that the membrane can be used for sensing pH levels in a variety of environments. Dipeptides are amphiphiles, meaning they have both hydrophilic and lipophilic properties. This makes them useful for forming self-assembled structures, such as hydrogels and membranes, that are capable of transporting water molecules through the structure.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease; Hydrochloride salt</p>

<p>Nicotinamide is a form of vitamin B3 that has been shown to inhibit the growth of Giardia lamblia trophozoites. Nicotinamide also inhibits the sirtuins and has been shown to inhibit cell cycle control in microorganisms. It inhibits transcriptional activity by competing with nicotinamide adenine dinucleotide for binding sites on DNA and prevents the formation of nicotinamide-adenine dinucleotide complexes, which are needed for DNA synthesis. Nicotinamide also binds to metronidazole, causing it to be inactive as an antimicrobial agent. The mechanism of action of nicotinamide may be due to its ability to bind and inactivate metronidazole, thereby preventing it from functioning as an anti-microbial agent.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Agonist of toll-like receptors TLR1/2</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Fmoc-Asp(OtBu)-(Dmb)Gly-OH is a peptide that has been synthesized by solid-phase synthesis. It has been designed to specifically bind to Lysine residues in proteins and can be used as a model protein with specificities for lysines. The sequence of the peptide is Fmoc-Asp(OtBu)-Dmb-Gly-OH. Fmoc-Asp(OtBu)-Dmb-Gly-OH is a novel chemical ligation strategy that uses an amide bond between the terminal amino group on the lysine and the alpha carboxyl group on the dipeptide, Dmb-(Dmb)Gly. This peptide is used for protein homeostasis, cellular functions, and modifications of proteins.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>