Peptides

<p>Lysine is an essential amino acid, which means that it cannot be synthesized by the body and must be obtained from food. It is a crucial component of many proteins, including enzymes and hormones. Lysine is also involved in calcium absorption, maintaining nitrogen balance, and the production of carnitine. Lysine hydrobromide is a salt form of lysine that can be used to inhibit protein synthesis in bacteria. This inhibition can take place at either the transcriptional or translational level, but not both simultaneously. The inhibition of protein synthesis prevents the cell from growing and reproducing. Lysine hydrobromide has been shown to have a regulatory effect on enzyme activities in corynebacterium glutamicum (a type of bacteria). It also acts as a substrate for uptake by corynebacterium glutamicum cells due to its high lysine content.</p>

<p>Please enquire for more information about Insulin B (22-25) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>N-Decyltetraoxyethylene is a fatty acid that can be synthesized by reacting naphthalene with ethylene oxide. It is used as a surfactant in pharmaceutical preparations and has been shown to have affinity for ligands such as anionic and cationic surfactants, fatty acids, and model proteins. N-Decyltetraoxyethylene also has antiviral properties, binding to influenza virus particles. This compound has been shown to exhibit bronchiolitis obliterans when administered to animals in vivo. The particle size of this compound is too small for it to be used as a respiratory inhalant drug, but the high surface area of the molecule allows it to be used as a nasal or eye drug.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Fmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Z-Ala-Ser-OH is a basic protein with a sequence of Z-Ala-Ser. It has a hydrophobic section and carboxylic acid group, which is why it is soluble in organic solvents. The dichroic spectra of this protein are characteristic for its secondary structure. This protein can be analyzed using the technique of dichroism, which allows one to determine its analogs as well as analyze its enzyme preparations. The amino acid residues found in this protein are Ala and Ser, which are basic and polar respectively.</p>

<p>H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.</p>

<p>Please enquire for more information about Boc-Cys(SO3H)-OH·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Met-Met-OH is a dietary supplement that has been shown to have a variety of health benefits in animals. It has been shown to increase the production of tnf-α and other fatty acids, which are known to play a role in cellular physiology. H-Met-Met-OH also has the ability to inhibit protein synthesis and this is thought to be due to its transport properties as well as its reaction products. H-Met-Met-OH can be taken orally or given through explants, either orally or by injection.</p>

<p>a chromogenic substrate for horseshoe crab clotting enzyme, which is used in quantitative assays of endotoxin.</p>

<p>Please enquire for more information about H-Ile-Arg-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Big Endothelin-1 (1-39), porcine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Fmoc-Lys(Boc)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-epsilon-azido-Nle-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bradykinin is a peptide hormone that is produced in the body and has various physiological effects, such as vasodilation, bronchoconstriction, and the release of histamine from mast cells. Bradykinin is also used in pharmacological treatments for malignant brain tumors, congestive heart failure, and epidermal growth factor-responsive dermatoses. Bradykinin can be administered intravenously or subcutaneously to treat these conditions. The drug can also be administered intraperitoneally to treat high blood pressure during pregnancy. Bradykinin is an ester of 3-b-(2-thienyl)-Ala5,Tyr(Me)8-psi(CH2NH)Arg9-OH with trifluoroacetic acid. It is synthesized by linking two molecules together through an ester bond. This drug has many beneficial effects on the human body due to its ability to inhibit enzymes that are involved in the production of prostagland</p>

<p>Isovaleryl-Val-Val-Sta-OEt is a peptide hormone and active inhibitor of the enzyme pepsin. This drug has been shown to have proteolytic activity in vitro, with a pepsin rate constant of 0.0015 min−1. It also inhibits the protease activity of trypsin, chymotrypsin, and elastase at a similar rate. Isovaleryl-Val-Val-Sta-OEt has been shown to be an active inhibitor of polymerase chain reaction (PCR) and reverse transcriptase activities. This drug is not absorbed through skin and can be used as a nonimmunogenic reagent for biochemical studies on water permeability and signal peptide sequences in biological samples.</p>

<p>Pmc-S-methylisothiourea is a synthetic compound that is used as a cross-coupling agent in organic synthesis. It has been shown to be an efficient and selective catalyst for Suzuki reactions. Pmc-S-methylisothiourea can be used to synthesize isoforms of macrolides, which are compounds with a skeleton similar to penicillin. Pmc-S-methylisothiourea can also be modified by adding ligands, such as thyronine, which can bind to hormone receptors and regulate transcription.</p>

<p>Kisspeptin P</p>

<p>Please enquire for more information about Glutaryl-Phe-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Delta-Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu-OH trifluoroacetate salt is a peptide that has been shown to have a hypnotic effect in mice. It was found to increase the time spent on the rotarod and decrease locomotor activity in mice. This drug has also been shown to be hypoglycemic and to modulate transcriptional regulation of fatty acid metabolism. Delta Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly Gly Glu OH trifluoroacetate salt may be useful in treating autoimmune diseases, such as multiple sclerosis, due to its ability to regulate 5HT concentrations.</p>