
Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29793 produits trouvés pour "Peptides"
H-ITPTDSR^-OH
Peptide H-ITPTDSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 96
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,753.1 g/molH-FGAVYSSDEAL^IPIR-OH
Peptide H-FGAVYSSDEAL^IPIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MOG 8 - 21
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,486.7 g/molSpinorphin, Bovine
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C45H64N8O10Masse moléculaire :877.04 g/molH-VFDEFKPL^VEEPQNL^IK-OH
Peptide H-VFDEFKPL^VEEPQNL^IK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
β-Amyloid (1-18)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :2,167.3 g/molAc-CDYEFEKHINLDQ-NH2
Peptide Ac-CDYEFEKHINLDQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YNQLLR^-OH
Peptide H-YNQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTSIQDWVQ^K^-OH
Peptide H-VTSIQDWVQ^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PRAME 301-309 (HLA-A*24)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Neuroendocrine Regulatory Peptide-1 (human)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C113H192N36O39Masse moléculaire :2,678.99 g/molDabcyl-AETFYVDG-Edans
Peptide Dabcyl-AETFYVDG-Edans is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 55
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,710.9 g/molH-2Kb Mouse Survivin MFFCFKEL
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-SGFSSVSVSR^-OH
Peptide H-SGFSSVSVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLSLTYDQK^-OH
Peptide H-LLSLTYDQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YQAIF^DNTTSLTDK-OH
Peptide H-YQAIF^DNTTSLTDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-NLVPMVATV-NH2
Peptide Ac-NLVPMVATV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SAYVSYDVQK^R^-OH
Peptide H-SAYVSYDVQK^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QGVAEAAGK^-OH
Peptide H-QGVAEAAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AMKRHGLDNYRGYSL-NH2
Peptide H-AMKRHGLDNYRGYSL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NPDDPDTVDVIMHMLDR^-OH
Peptide H-NPDDPDTVDVIMHMLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Secretoneurin (rat)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C159H252N40O58Masse moléculaire :3,651.98 g/molH-GDSLAYGLR^-OH
Peptide H-GDSLAYGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EFTPQMQAAYQK^-OH
Peptide H-EFTPQMQAAYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EVTNFLR^-OH
Peptide H-EVTNFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CTHGTSMNRVIEEDGTSA-OH PAB-406-1589A
Peptide Ac-CTHGTSMNRVIEEDGTSA-OH PAB-406-1589A is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Octanoyl-RWKFGGFKWR-OH
Peptide Octanoyl-RWKFGGFKWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 111
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,695 g/molH-GDYDLNAVR^-OH
Peptide H-GDYDLNAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
GAD65 (206-220)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C86H129N15O24Masse moléculaire :1,757.07 g/molH-QYFFET^K-OH
Peptide H-QYFFET^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-88/aa349 - 363
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,449.7 g/molH-AVHKAVLTIDEK^-OH
Peptide H-AVHKAVLTIDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CAQAGLKPEQA-NH2
Peptide Ac-CAQAGLKPEQA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
BAM (8-22)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C91H127N25O23SMasse moléculaire :1,971.2 g/molH-IIDNKPSIDSYSK^-OH
Peptide H-IIDNKPSIDSYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
NR-Box 2 Peptide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,574.9 g/molH-KFRKAFKRFF-NTPEGBiot
Peptide H-KFRKAFKRFF-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-His-Ala-OH
CAS :H-His-Ala-OH is a peptide hormone that is derived from the amino acid histidine. It has been shown to be a potent inhibitor of tumor growth in human breast cancer tissue and human serum. H-His-Ala-OH inhibits the release of peptide hormones, such as insulin and glucagon. This compound also has anti-inflammatory properties, which may be due to its ability to inhibit the production of prostaglandins. H-His-Ala-OH interacts with collagen via a number of mechanisms, including inhibition of proteolytic enzymes and binding with collagenase. H-His-Ala-OH also binds to casein, which is found in milk. The interaction between casein and H-His-Ala-OH leads to an increase in systolic blood pressure in rats and mice.Formule :C9H14N4O3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :226.23 g/molH-ISVYYNEASSHK^-OH
Peptide H-ISVYYNEASSHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LGRI-NH2
Peptide Ac-LGRI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSITGTYDLK^-OH
Peptide H-LSITGTYDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VISPSEDR^-OH
Peptide H-VISPSEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-Glu-Lys-Lys-AMC acetate salt
CAS :Boc-Glu-Lys-Lys-AMC acetate salt is a synthetic, potent inhibitor of trypsin and other serine proteases. It is a basic protein with a molecular weight of 9,000 Da that has been obtained by chemical synthesis. This inhibitor binds to the active site of the enzyme and prevents it from cleaving peptide bonds. Boc-Glu-Lys-Lys-AMC acetate salt is an activator of plasminogen in vitro, which may be due to its ability to bind to lysine residues on the surface of tissue plasminogen activator.Formule :C32H48N6O9•C2H4O2Degré de pureté :Min. 97 Area-%Couleur et forme :PowderMasse moléculaire :720.81 g/molHCMV pp65 363-373 (HLA-A*01:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-IR^QYLAQWLE-OH
Peptide H-IR^QYLAQWLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
