Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29860 produits trouvés pour "Peptides"
H-TTP^P^V^LDSDGSYFLYSK^-OH
Peptide H-TTP^P^V^LDSDGSYFLYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Leuprolide Human
Leuprolide is a synthetic hormone that is used for the treatment of prostate cancer. It works by blocking the production of hormones called luteinizing hormone and follicle-stimulating hormone in the body. Leuprolide is also used to treat endometriosis, uterine fibroids, and early puberty. This drug has been shown to have an inhibitory effect on prostate cancer cells in vitro and in vivo.Formule :C59H84N16O12Degré de pureté :Min. 95%Masse moléculaire :1208.64546H-R^MFPNAPYL-OH
Peptide H-R^MFPNAPYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-KTWGQYWQV-OH
Peptide Biot-KTWGQYWQV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVAANIVL^TV-OH
Peptide H-AVAANIVL^TV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Presenilin-1 (S182 Protein) (431-467) (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :4,299.09 g/molH-GSPAINVAVHVFR^-OH
Peptide H-GSPAINVAVHVFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Asp(OtBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Asp(OtBu)-2-ClTrt-Resin is a resin that is used for peptide synthesis. It can be used in the synthesis of building blocks, such as thiols, alcohols, amines, and so on. H-Asp(OtBu)-2-ClTrt-Resin can be found in the Tools for Peptide Synthesis category.
Degré de pureté :Min. 95%Ac-FYWHCLDE-OH
Peptide Ac-FYWHCLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CLEAR-Acid Resin (100-200 mesh)
CLEAR-Acid Resin (100-200 mesh) is a high purity resin that is used for peptide synthesis. It has been used in research as an activator and inhibitor of protein interactions, such as receptor-ligand and antibody-antigen. CLEAR-Acid Resin (100-200 mesh) is often used in antibody production, where it binds to the antigen and activates the immune response against it. CLEAR-Acid Resin (100-200 mesh) has also been used for ion channel research due to its ability to inhibit potassium channels in neuronal cells. The CAS Number for CLEAR-Acid Resin (100-200 mesh) isDegré de pureté :Min. 95%H-GWVTDGFSSL^K-OH
Peptide H-GWVTDGFSSL^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FPLTNAIK^-OH
Peptide H-FPLTNAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Glu4]-Oxytocin
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C43H65N11O13S2Masse moléculaire :1,008.17 g/molH-STDTAYMELSSLR^-OH
Peptide H-STDTAYMELSSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Fam-VLQWAEKGYYTMSNN-OH
Peptide 5Fam-VLQWAEKGYYTMSNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Crotonic-FYWHCLDE-OH
Peptide Crotonic-FYWHCLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
NAP Peptide
CAS :NAP peptide is a neuroprotective compound that has been shown to be effective in reducing neuronal death and protecting against oxidative stress. NAP peptide binds to the surface glycoprotein of the neuron, which is involved in the regulation of iron homeostasis. The hydroxyl group on NAP peptide acts as a hydrogen-bond acceptor, stabilizing the protein and forming an ester linkage with it. This binding prevents the degradation of proteins by proteases and prevents neuronal death by inhibiting apoptosis. NAP peptide also has neurotrophic effects, which are beneficial for diabetic neuropathy and autoimmune diseases.Formule :C36H60N10O12Degré de pureté :Min. 95%Masse moléculaire :824.94 g/molFlagellin 22 (flg22)
Flagellin is a structural protein which forms the major portion of bacterial flagellar filaments. The N- and C-terminals of flagellin are highly conserved regions, whereas the central core can vary greatly between bacterial species. Flagellin 22 (flg22) is the stretch of amino acids most conserved across bacterial species and is located towards the N-terminal of the flagellin protein.Flg22 is a potent elicitor of plant immune responses and is recognised in plants by the membrane bound leucine-rich repeat-receptor kinase FLAGELLIN SENSITIVE 2 (FLS2). Flg22 induces defence gene expression to trigger both local and systemic immune responses and is thus widely used in plant defence studies.Couleur et forme :PowderMasse moléculaire :2,272.48 g/molH-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVL^VQREKDL^PNYNWNSFGL^RF-NH2
H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Formule :C258H401N79O78Masse moléculaire :5,857.5 g/molH-SSATTFRLLWENGNLLR^-OH
Peptide H-SSATTFRLLWENGNLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TANDLNLLILR^-OH
Peptide H-TANDLNLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ARTKQTARKSTGGKAPRKQLY-NH2
Peptide H-ARTKQTARKSTGGKAPRKQLY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-DERAA-NH2
Peptide Ac-DERAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLYANTVL^SGGTTMYPGIADR-OH
Peptide H-DLYANTVL^SGGTTMYPGIADR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IQSFLGGAPTEDLK^-OH
Peptide H-IQSFLGGAPTEDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLAFIQDPDGYWIEILNPNK^-OH
Peptide H-GLAFIQDPDGYWIEILNPNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HEAWITLEK^-OH
Peptide H-HEAWITLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-VPWMEPAYQRFL-OH
Peptide LCBiot-VPWMEPAYQRFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IKGEEKVAPYHVQYTCLHENLC-NH2
Peptide H-IKGEEKVAPYHVQYTCLHENLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Antihypertensive peptide ITTNP
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C23H40N6O9Masse moléculaire :544.6 g/molδ-MSH
Peptide ÎŽ-MSH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C74H99N21O16SMasse moléculaire :1,570.81 g/molFmoc-Asp(OtBu)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Asp(OtBu)-Wang resin is a 1% DVB resin that can be used as an inhibitor of peptide synthesis. It has been shown to selectively inhibit the binding of the L-type calcium channel, which is a cell membrane protein that affects the transport of calcium ions in and out of cells. Fmoc-Asp(OtBu)-Wang resin binds to the receptor site, preventing the natural ligand from binding. This inhibition prevents the activation of ion channels and reduces calcium ion influx into cells, leading to an anti-inflammatory effect.Degré de pureté :Min. 95%H-FFVPPFQQSPR^-OH
Peptide H-FFVPPFQQSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QFYDQALQQAVVDDDANNAK^-OH
Peptide H-QFYDQALQQAVVDDDANNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLLFRKIRRLKR-NH2
Peptide H-RLLFRKIRRLKR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-KFVAAWTL-NH2
Peptide Ac-KFVAAWTL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Secretin (rat)
CAS :Secretin is a gastrointestinal hormone secreted by S cells in the small intestine, targeting G-protein coupled secretin receptors in numerous cell types. Secretin is synthesised from the preprohormone pro-secretin and is involved in regulating gastric acid and bicarbonate ion secretion in the duodenum and regulating water homeostasis. During glucose intake, secretin stimulates the pancreas to release insulin.Secretin has clinical relevance as a method to detect gastrin-producing tumours. Administration of exogenous secretin to the duodenum for secretin stimulation test to occur. Secretin can also be used to detect pancreatic insufficiencies via s administration during endoscopic retrograde cholangiopancreatography (ERCP). This allows the detection of inflammatory and neoplastic conditions of the pancreas.Secretin plays a different role in the central nervous system, such that in secretin deficient mice, synaptic plasticity and hippocampal synaptic activity are altered. Thus, secretin can be categorised as a neuropeptide.Formule :C129H216N42O42Masse moléculaire :3,027.36 g/molLeptin (116-130) Mouse
Leptin is a member of the adipocytokines or adipokines group of cytokines which are primarily produced in adipose tissue. Leptin is both a hormone involved in multiple endocrine functions, bone metabolism and thermoregulation, and a cytokine that promotes inflammatory responses. People with obesity have elevated levels of leptin. This contributes to the state of low-grade inflammation that makes those individuals more likely to develop cardiovascular diseases, type II diabetes, degenerative disease and autoimmune disease. Reduced levels of leptin, found in malnourished individuals, has been linked to an increased risk of infection and reduced cell-mediated immunity.Leptin binds to leptin receptors (ObRs), of which there are at least six isoforms (ObRa, ObRb, ObRc, ObRd, ObRe, and ObRf). This fragment of leptin has been shown to restrict weight gain and food intake in female mice lacking active leptin.Couleur et forme :PowderMasse moléculaire :1,559.8 g/molH-DLPAPITR^-OH
Peptide H-DLPAPITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPPGFSPFR^-OH
Peptide H-RPPGFSPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-THNVLER^-OH
Peptide H-THNVLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-98
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,663 g/molH-NFLINETAR^-OH
Peptide H-NFLINETAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGQLEEQLEQEAK^-OH
Peptide H-IGQLEEQLEQEAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLWEWASVR^-OH
Peptide H-YLWEWASVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TFPGFFSPMLGEFVSETESR^-OH
Peptide H-TFPGFFSPMLGEFVSETESR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Click MitP
MitP cell penetrating peptide labelled at the N-terminus with an alkyne attachment for ease of reaction with an opposite Click reactive partner (azide).Couleur et forme :PowderMasse moléculaire :1,601.1 g/molCyclo(Arg-Gly-Asp-D-Tyr-Glu)
Cyclo(Arg-Gly-Asp-D-Tyr-Glu) is a peptide macrocyclic compound that has been used as a radiolabeling agent for peptides. This compound is an analogue of cyclo(Arg-Gly-Asp), which is a biologically active peptide found in many cell surface receptors. Cyclo(Arg-Gly-Asp) has been shown to have antiangiogenic and antiapoptotic properties.Formule :C26H36N8O10Degré de pureté :Min. 95%Masse moléculaire :620.62 g/mol
![[Glu4]-Oxytocin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50809.webp&w=3840&q=75)
