CymitQuimica logo
Peptides

Peptides

Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.

Sous-catégories appartenant à la catégorie "Peptides"

29863 produits trouvés pour "Peptides"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • H-VGTQFIR^-OH


    Peptide H-VGTQFIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48086

    ne
    À demander
  • H-DSPVLIDFFEDTER^-OH


    Peptide H-DSPVLIDFFEDTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40707

    ne
    À demander
  • SARS-CoV-2 Antigen Peptide NCAP (LLNKHIDAYKTFPPTEPK)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C99H154N24O27
    Masse moléculaire :2,112.55 g/mol

    Ref: 3D-PP50629

    ne
    À demander
  • H-VGDTSLDPNDFDFTVTGR^-OH


    Peptide H-VGDTSLDPNDFDFTVTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42135

    ne
    À demander
  • Boc-LGR^-OH


    Peptide Boc-LGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49770

    ne
    À demander
  • Ac-WDCCPGCCK-NH2


    Peptide Ac-WDCCPGCCK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44808

    ne
    À demander
  • Ac-TNL-NH2


    Peptide Ac-TNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43517

    ne
    À demander
  • H-GFQALGDAADIR^-OH


    Peptide H-GFQALGDAADIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43494

    ne
    À demander
  • H-ALQVVR^-OH


    Peptide H-ALQVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40947

    ne
    À demander
  • H-PAFSAIR^-OH


    Peptide H-PAFSAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40549

    ne
    À demander
  • H-IL^DTAGREEY-OH


    Peptide H-IL^DTAGREEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40407

    ne
    À demander
  • H-ELL^ETGDNR^-OH


    Peptide H-ELL^ETGDNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41233

    ne
    À demander
  • LCBiot-SGRGKGGKGLGKGGAKRHRKV-NH2


    Peptide LCBiot-SGRGKGGKGLGKGGAKRHRKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45308

    ne
    À demander
  • HXB2 gag NO-54/aa213 - 227


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Masse moléculaire :1,550.7 g/mol

    Ref: 3D-PP50228

    ne
    À demander
  • H-FLLTR^ILTI^-OH


    Peptide H-FLLTR^ILTI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41799

    ne
    À demander
  • HXB2 gag NO-82/aa325 - 339


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,554.8 g/mol

    Ref: 3D-PP50949

    ne
    À demander
  • H-TESTLNALLQR^-OH


    Peptide H-TESTLNALLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41339

    ne
    À demander
  • H-IRPFF^PQ-OH


    Peptide H-IRPFF^PQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40247

    ne
    À demander
  • Substance P -Gly-Lys


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C71H112N20O16S
    Masse moléculaire :1,533.8 g/mol

    Ref: 3D-PP50606

    ne
    À demander
  • H-SYPSNATCPR^-OH


    Peptide H-SYPSNATCPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49826

    ne
    À demander
  • H-GTYLTDETHR^-OH


    Peptide H-GTYLTDETHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41049

    ne
    À demander
  • H-LSITGTYDLK^-OH


    Peptide H-LSITGTYDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44393

    ne
    À demander
  • H-LDVHYAPTIR^-OH


    Peptide H-LDVHYAPTIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42583

    ne
    À demander
  • H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH


    Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47702

    ne
    À demander
  • H-NGFYPATR^-OH


    Peptide H-NGFYPATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41115

    ne
    À demander
  • H-LLSLTYDQK^-OH


    Peptide H-LLSLTYDQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42315

    ne
    À demander
  • H-DANISQPETTK^-OH


    Peptide H-DANISQPETTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40675

    ne
    À demander
  • Carcinoembryonic antigen-related cell adhesion molecule 5 (691-699)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Ref: 3D-PP50734

    ne
    À demander
  • Ac-RLIEDICLPRWGCLWEDD-NH2


    Peptide Ac-RLIEDICLPRWGCLWEDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43386

    ne
    À demander
  • H-Gly-Leu-Gly-OH

    CAS :
    Gly-Leu-Gly is a peptide that has a conformation in which the side chain of the amino acid glycine is attached to the alpha-carbon atom of the amino acid leucine. It is a labile molecule, meaning that it can react with other molecules or break down spontaneously. Gly-Leu-Gly is also called glycylleucine. This peptide has been found to have protonation properties that depend on temperature and kinetic energy. The carbonyl group of this peptide interacts with other molecules by donating or accepting electrons. In addition, this compound can be analyzed using spectrometers and gas chromatographs.
    Formule :C10H19N3O4
    Masse moléculaire :245.28 g/mol

    Ref: 3D-FG109029

    ne
    À demander
  • HXB2 gag NO-13


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,603.8 g/mol

    Ref: 3D-PP50593

    ne
    À demander
  • H-AATVGSLAGQPLQER^-OH


    Peptide H-AATVGSLAGQPLQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41225

    ne
    À demander
  • H-YMLDL^QPETT-OH


    Peptide H-YMLDL^QPETT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43487

    ne
    À demander
  • Ac-KKKKKRFSFKKSFKLSGFSFKKNKK-NH2


    Peptide Ac-KKKKKRFSFKKSFKLSGFSFKKNKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49527

    ne
    À demander
  • H-Leu-Tyr-OH

    CAS :
    H-Leu-Tyr-OH is a biphasic response amide with two phenyl groups and a primary amino group. It is most active at pH 6.5, but can be used at higher or lower pHs. The rate of H-Leu-Tyr-OH formation is highest in triticum aestivum (wheat) butyric acid extract. H-Leu-Tyr-OH has been shown to have excitatory effects on plant physiology, which may be due to its ability to bind to the specific antibody against acetylcholine receptors.
    Formule :C15H22N2O4
    Masse moléculaire :294.35 g/mol

    Ref: 3D-FL108104

    ne
    À demander
  • H-ISTLNSLTLPALR^-OH


    Peptide H-ISTLNSLTLPALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41841

    ne
    À demander
  • H-GDSLAYGLR^-OH


    Peptide H-GDSLAYGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45253

    ne
    À demander
  • H-YGGFLRRIR^PKLKWDNQ-OH


    Peptide H-YGGFLRRIR^PKLKWDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49359

    ne
    À demander
  • Cys-Kemptide

    CAS :

    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C35H66N14O10S1
    Masse moléculaire :875.1 g/mol

    Ref: 3D-PP50701

    ne
    À demander
  • H-TIVTTLQDSIR^-OH


    Peptide H-TIVTTLQDSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40759

    ne
    À demander
  • H-QTISNACGTIGLIHAIANNK^-OH


    Peptide H-QTISNACGTIGLIHAIANNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41195

    ne
    À demander
  • H-VNTL^TER-OH


    Peptide H-VNTL^TER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48799

    ne
    À demander
  • H-DGVPVIK^-OH


    Peptide H-DGVPVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40955

    ne
    À demander
  • H-SGSVIDQSR^-OH


    Peptide H-SGSVIDQSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40403

    ne
    À demander
  • H-YGGFLRRQFK^VVT-OH


    Peptide H-YGGFLRRQFK^VVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49519

    ne
    À demander
  • H-ISAPNVDFNLEGPK^-OH


    Peptide H-ISAPNVDFNLEGPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45894

    ne
    À demander
  • H-SELEEQLTPVAEETR^-OH


    Peptide H-SELEEQLTPVAEETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42917

    ne
    À demander
  • H-TWNDPSVQQDI^K^-OH


    Peptide H-TWNDPSVQQDI^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44921

    ne
    À demander
  • H-FIPLIPIPER^-OH


    Peptide H-FIPLIPIPER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40777

    ne
    À demander
  • Experimental Allergic Encephalitogenic Peptide (human)

    CAS :

    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C46H64N14O14
    Masse moléculaire :1,037.11 g/mol

    Ref: 3D-PP50417

    ne
    À demander