
Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29863 produits trouvés pour "Peptides"
H-VGTQFIR^-OH
Peptide H-VGTQFIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DSPVLIDFFEDTER^-OH
Peptide H-DSPVLIDFFEDTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SARS-CoV-2 Antigen Peptide NCAP (LLNKHIDAYKTFPPTEPK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C99H154N24O27Masse moléculaire :2,112.55 g/molH-VGDTSLDPNDFDFTVTGR^-OH
Peptide H-VGDTSLDPNDFDFTVTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-LGR^-OH
Peptide Boc-LGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-WDCCPGCCK-NH2
Peptide Ac-WDCCPGCCK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-TNL-NH2
Peptide Ac-TNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GFQALGDAADIR^-OH
Peptide H-GFQALGDAADIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALQVVR^-OH
Peptide H-ALQVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PAFSAIR^-OH
Peptide H-PAFSAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IL^DTAGREEY-OH
Peptide H-IL^DTAGREEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELL^ETGDNR^-OH
Peptide H-ELL^ETGDNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-SGRGKGGKGLGKGGAKRHRKV-NH2
Peptide LCBiot-SGRGKGGKGLGKGGAKRHRKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-54/aa213 - 227
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,550.7 g/molH-FLLTR^ILTI^-OH
Peptide H-FLLTR^ILTI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-82/aa325 - 339
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,554.8 g/molH-TESTLNALLQR^-OH
Peptide H-TESTLNALLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IRPFF^PQ-OH
Peptide H-IRPFF^PQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Substance P -Gly-Lys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C71H112N20O16SMasse moléculaire :1,533.8 g/molH-SYPSNATCPR^-OH
Peptide H-SYPSNATCPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTYLTDETHR^-OH
Peptide H-GTYLTDETHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSITGTYDLK^-OH
Peptide H-LSITGTYDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDVHYAPTIR^-OH
Peptide H-LDVHYAPTIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NGFYPATR^-OH
Peptide H-NGFYPATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLSLTYDQK^-OH
Peptide H-LLSLTYDQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DANISQPETTK^-OH
Peptide H-DANISQPETTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Carcinoembryonic antigen-related cell adhesion molecule 5 (691-699)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAc-RLIEDICLPRWGCLWEDD-NH2
Peptide Ac-RLIEDICLPRWGCLWEDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Gly-Leu-Gly-OH
CAS :Gly-Leu-Gly is a peptide that has a conformation in which the side chain of the amino acid glycine is attached to the alpha-carbon atom of the amino acid leucine. It is a labile molecule, meaning that it can react with other molecules or break down spontaneously. Gly-Leu-Gly is also called glycylleucine. This peptide has been found to have protonation properties that depend on temperature and kinetic energy. The carbonyl group of this peptide interacts with other molecules by donating or accepting electrons. In addition, this compound can be analyzed using spectrometers and gas chromatographs.Formule :C10H19N3O4Masse moléculaire :245.28 g/molHXB2 gag NO-13
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,603.8 g/molH-AATVGSLAGQPLQER^-OH
Peptide H-AATVGSLAGQPLQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YMLDL^QPETT-OH
Peptide H-YMLDL^QPETT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-KKKKKRFSFKKSFKLSGFSFKKNKK-NH2
Peptide Ac-KKKKKRFSFKKSFKLSGFSFKKNKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Leu-Tyr-OH
CAS :H-Leu-Tyr-OH is a biphasic response amide with two phenyl groups and a primary amino group. It is most active at pH 6.5, but can be used at higher or lower pHs. The rate of H-Leu-Tyr-OH formation is highest in triticum aestivum (wheat) butyric acid extract. H-Leu-Tyr-OH has been shown to have excitatory effects on plant physiology, which may be due to its ability to bind to the specific antibody against acetylcholine receptors.Formule :C15H22N2O4Masse moléculaire :294.35 g/molH-ISTLNSLTLPALR^-OH
Peptide H-ISTLNSLTLPALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDSLAYGLR^-OH
Peptide H-GDSLAYGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YGGFLRRIR^PKLKWDNQ-OH
Peptide H-YGGFLRRIR^PKLKWDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cys-Kemptide
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C35H66N14O10S1Masse moléculaire :875.1 g/molH-TIVTTLQDSIR^-OH
Peptide H-TIVTTLQDSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QTISNACGTIGLIHAIANNK^-OH
Peptide H-QTISNACGTIGLIHAIANNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VNTL^TER-OH
Peptide H-VNTL^TER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DGVPVIK^-OH
Peptide H-DGVPVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGSVIDQSR^-OH
Peptide H-SGSVIDQSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YGGFLRRQFK^VVT-OH
Peptide H-YGGFLRRQFK^VVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISAPNVDFNLEGPK^-OH
Peptide H-ISAPNVDFNLEGPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SELEEQLTPVAEETR^-OH
Peptide H-SELEEQLTPVAEETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TWNDPSVQQDI^K^-OH
Peptide H-TWNDPSVQQDI^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FIPLIPIPER^-OH
Peptide H-FIPLIPIPER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Experimental Allergic Encephalitogenic Peptide (human)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C46H64N14O14Masse moléculaire :1,037.11 g/mol
